Property Summary

NCBI Gene PubMed Count 13
Grant Count 7
R01 Count 4
Funding $863,666.17
PubMed Score 9.34
PubTator Score 8.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Dystonia 77 4.28 2.1

Expression

Gene RIF (5)

PMID Text
26041288 The Torsin Activator LULL1 Is Required for Efficient Growth of Herpes Simplex Virus 1.
25352667 LAP1 and LULL1 regulate Torsin ATPase activity through an active site complementation mechanism.
23569223 LAP1 and LULL1 as regulatory cofactors that are responsible for the activation of TorA's ATPase activity.
19339278 Data suggest that LULL1 regulates the distribution and activity of TorA within the ER and NE lumen and reveal functional defects in the mutant protein responsible for DYT1 dystonia.
15767459 identifed a novel transmembrane protein, lumenal domain like LAP1 (LULL1), which appears to interact with torsinA; it resides in the main endoplasmic reticulum.

AA Sequence

MADSGLREPQEDSQKDLENDPSVNSQAQETTIIASNAEEAEILHSACGLSKDHQEVETEGPESADTGDKS      1 - 70
ESPDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPSDKVGRADAHLGSSSVALP     71 - 140
KEASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLRRRLLAPEAGSHPQQTQKLEEIKENAQDTMRQI    141 - 210
NKKGFWSYGPVILVVLVVAVVASSVNSYYSSPAQQVPKNPALEAFLAQFSQLEDKFPGQSSFLWQRGRKF    211 - 280
LQKHLNASNPTEPATIIFTAAREGRETLKCLSHHVADAYTSSQKVSPIQIDGAGRTWQDSDTVKLLVDLE    281 - 350
LSYGFENGQKAAVVHHFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLEASVGPRETEEKVRD    351 - 420
LLWAKFTNSDTPTSFNHMDSDKLSGLWSRISHLVLPVQPVSSIEEQGCLF                        421 - 470
//

Text Mined References (20)

PMID Year Title
26041288 2015 The Torsin Activator LULL1 Is Required for Efficient Growth of Herpes Simplex Virus 1.
25416956 2014 A proteome-scale map of the human interactome network.
25352667 2014 The mechanism of Torsin ATPase activation.
24275647 2014 Arresting a Torsin ATPase reshapes the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23569223 2013 Regulation of Torsin ATPases by LAP1 and LULL1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...