Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.23
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
periodontitis 269
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
periodontitis -1.400 0.000
psoriasis 1.100 0.000

Gene RIF (1)

PMID Text
12185532 BPIL2maps to Chr 22q13. AA sequence is reported.

AA Sequence

MCTKTIPVLWGCFLLWNLYVSSSQTIYPGIKARITQRALDYGVQAGMKMIEQMLKEKKLPDLSGSESLEF      1 - 70
LKVDYVNYNFSNIKISAFSFPNTSLAFVPGVGIKALTNHGTANISTDWGFESPLFQDTGGADLFLSGVYF     71 - 140
TGIIILTRNDFGHPTLKLQDCYAQLSHAHVSFSGELSVLYNSFAEPMEKPILKNLNEMLCPIIASEVKAL    141 - 210
NANLSTLEVLTKIDNYTLLDYSLISSPEITENYLDLNLKGVFYPLENLTDPPFSPVPFVLPERSNSMLYI    211 - 280
GIAEYFFKSASFAHFTAGVFNVTLSTEEISNHFVQNSQGLGNVLSRIAEIYILSQPFMVRIMATEPPIIN    281 - 350
LQPGNFTLDIPASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFRLALPESNRSNIE    351 - 420
VLRFENILSSILHFGVLPLANAKLQQGFPLSNPHKFLFVNSDIEVLEGFLLISTDLKYETSSKQQPSFHV    421 - 490
WEGLNLISRQWRGKSAP                                                         491 - 507
//

Text Mined References (7)

PMID Year Title
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185532 2002 Three new human members of the lipid transfer/lipopolysaccharide binding protein family (LT/LBP).
10591208 1999 The DNA sequence of human chromosome 22.