Property Summary

NCBI Gene PubMed Count 12
PubMed Score 46.31
PubTator Score 30.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.186 0.001
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.013
medulloblastoma, large-cell -1.200 0.015
sonic hedgehog group medulloblastoma 1.100 0.000
Breast cancer -1.400 0.001
psoriasis -1.200 0.000

Synonym

Accession Q8NFP7 A8K7D7 D3DX69 Q86VK1 Q86VR0 DIPP-3-alpha
Symbols APS2
DIPP3a
DIPP3-alpha

Gene

PANTHER Protein Class (2)

PDB

3MCF  

Gene RIF (4)

PMID Text
21071540 Observational study of gene-disease association. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
12121577 Cloning and characterisation of NUDT10 as a diadenosine polyphosphate-metabolising Nudix hydrolase.
12105228 The NUDT10 gene, located on chromosome X, is preferentially expressed in the testis

AA Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA      1 - 70
GVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGGSPTNGNSMAPSSPDSDP                                                  141 - 164
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
18264098 2008 Common sequence variants on 2p15 and Xp11.22 confer susceptibility to prostate cancer.
18264097 2008 Multiple newly identified loci associated with prostate cancer susceptibility.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...