Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.91
PubTator Score 8.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Synonym

Accession Q8NFP4 A6NHG0 Q8NBE3
Symbols GPIM
MAMDC3

Gene

Gene RIF (7)

PMID Text
21146959 The MDGA1 gene may confer risk to schizophrenia and bipolar disorder in Chinese Han population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20036297 Observational study of gene-disease association. (HuGE Navigator)
18384059 MDGA1 is a new schizophrenia susceptibility gene, and altered neuronal migration is involved in SZ pathology.
18384059 Observational study of gene-disease association. (HuGE Navigator)
15922729 MDGA1, a novel glycosylphosphatidylinositol-anchored protein, is localized in lipid rafts.
12082541 A novel human gene mapped to chromosome 6p21, encodes a putative glycosylphosphatidylinositol (GPI) anchored protein containing a MAM (meprin, A5 antigen, protein tyrosine phosphatase mu) domain. (GPIM)

AA Sequence

MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQV      1 - 70
RWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTV     71 - 140
SDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQDNGVDIYEPLYTQGETKVLKLKNLRPQDYA    141 - 210
SYTCQVSVRNVCGIPDKAITFRLTNTTAPPALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPG    211 - 280
PLPLGALAQGGTLSIPSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLG    281 - 350
QDLKLSCHVDAVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFP    351 - 420
GAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDKEAALLPSGLP    421 - 490
LEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQLNVQFPPEVEPSSQDVRQALGRPVLLRC    491 - 560
SLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAACLFQV    561 - 630
SAKAYSPEFYFDTPNPTRSHKLSKNYSYVLQWTQREPDAVDPVLNYRLSIRQLNQHNAVVKAIPVRRVEK    631 - 700
GQLLEYILTDLRVPHSYEVRLTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDEKICGYTQDLTDN    701 - 770
FDWTRQNALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFFYHM    771 - 840
YGKHIGSLNLLVRSRNKGALDTHAWSLSGNKGNVWQQAHVPISPSGPFQIIFEGVRGPGYLGDIAIDDVT    841 - 910
LKKGECPRKQTDPNKVVVMPGSGAPCQSSPQLWGPMAIFLLALQR                             911 - 955
//

Text Mined References (13)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23248271 2013 MDGAs interact selectively with neuroligin-2 but not other neuroligins to regulate inhibitory synapse development.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21146959 2011 The MDGA1 gene confers risk to schizophrenia and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20036297 2009 WITHDRAWN: Common polymorphisms in the MDGA1 gene are associated with bipolar disorder and schizophrenia in the Chinese Han population.
18384059 2008 Association analysis of schizophrenia on 18 genes involved in neuronal migration: MDGA1 as a new susceptibility gene.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15922729 2005 Characterization of MDGA1, a novel human glycosylphosphatidylinositol-anchored protein localized in lipid rafts.
15019943 2004 Identification and characterization of two novel brain-derived immunoglobulin superfamily members with a unique structural organization.
More...