Property Summary

NCBI Gene PubMed Count 3
PubMed Score 76.46
PubTator Score 21.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q8NFP0 J3KR74
Symbols STEPP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MKKKHDGIVYETKEVLNPSPKVTHCCKSLWLKYSFQKAYMTQLVSSQPVPAMSRNPDHNLLSQPKEHSIV      1 - 70
QKHHQEEIIHKLAMQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHLL           71 - 134
//

Text Mined References (5)

PMID Year Title