Property Summary

NCBI Gene PubMed Count 3
Grant Count 3
Funding $745,624
PubMed Score 73.31
PubTator Score 21.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (2)

PMID Text
20068295 Data show that CCDC33-dsRED fusion protein co-localized with a known peroxisomal protein, namely PXT1, and showed punctuate intracellular distribution.
18160785 Pxt1 gene is so far the first gene coding for a putative peroxisomal protein which is expressed in later steps of spermatogenesis, namely in pachytene spermatocytes

AA Sequence

MKKKHDGIVYETKEVLNPSPKVTHCCKSLWLKYSFQKAYMTQLVSSQPVPAMSRNPDHNLLSQPKEHSIV      1 - 70
QKHHQEEIIHKLAMQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHLL           71 - 134
//

Text Mined References (5)

PMID Year Title
20068295 2009 Ccdc33, a predominantly testis-expressed gene, encodes a putative peroxisomal protein.
18160785 2007 The putative peroxisomal gene Pxt1 is exclusively expressed in the testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.