Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.33
PubTator Score 3.00

Knowledge Summary

Patent (386)

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 9.5e-08
severe asthma 9 5.0e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 0.8
Disease Target Count Z-score Confidence
Autoimmune hemolytic anemia 31 3.658 1.8
Pancytopenia 45 3.136 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.826 9.5e-08
severe asthma -1.200 5.0e-07

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MEPEINCSELCDSFPGQELDRRPLHDLCKTTITSSHHSSKTISSLSPVLLGIVWTFLSCGLLLILFFLAF      1 - 70
TIHCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFGIQDVLVGSSMETLIQTRLSMLCIGTSLVFGPILG     71 - 140
KSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALLMADVILLMTWVLTDPIQCLQILSVSMTVTGKDVSCTS    141 - 210
TSTHFCASRYSDVWIALIWGCKGLLLLYGAYLAGLTGHVSSPPVNQSLTIMVGVNLLVLAAGLLFVVTRY    211 - 280
LHSWPNLVFGLTSGGIFVCTTTINCFIFIPQLKQWKAFEEENQTIRRMAKYFSTPNKSFHTQYGEEENCH    281 - 350
PRGEKSSMERLLTEKNAVIESLQEQVNNAKEKIVRLMSAECTYDLPEGAAPPASSPNKDVQAVASVHTLA    351 - 420
AAQGPSGHLSDFQNDPGMAARDSQCTSGPSSYAQSLEGPGKDSSFSPGKEEKISDSKDFSDHLDSGCSQK    421 - 490
PWTEQSLGPERGDQVPMNPSQSLLPERGGSDPQRQRHLENSEEPPERRSRVSSVIREKLQEVLQDLGLGP    491 - 560
EASLSTAPSCHQQTWKNSAAFSPQKMPLSKELGFSPYMVRRRRAAQRARSHFPGSAPSSVGHRANRTVPG    561 - 630
AHSRLHVQNGDSPSLAPQTTDSRVRRPSSRKPSLPSDPQDRPGTLEGSKQSQTEPEGARGSKAAFLRQPS    631 - 700
GSGRAPSPAAPCLSKASPDLPEQWQLWPPVPSGCASLSSQHSYFDTESSSSDEFFCRCHRPYCEICFQSS    701 - 770
SDSSDSGTSDTDPEPTGGLASWEKLWARSKPIVNFKDDLKPTLV                              771 - 814
//

Text Mined References (7)

PMID Year Title