Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.33
PubTator Score 3.00

Knowledge Summary

Patent (386)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.826 0.000
severe asthma -1.200 0.000

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPEINCSELCDSFPGQELDRRPLHDLCKTTITSSHHSSKTISSLSPVLLGIVWTFLSCGLLLILFFLAF      1 - 70
TIHCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFGIQDVLVGSSMETLIQTRLSMLCIGTSLVFGPILG     71 - 140
KSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALLMADVILLMTWVLTDPIQCLQILSVSMTVTGKDVSCTS    141 - 210
TSTHFCASRYSDVWIALIWGCKGLLLLYGAYLAGLTGHVSSPPVNQSLTIMVGVNLLVLAAGLLFVVTRY    211 - 280
LHSWPNLVFGLTSGGIFVCTTTINCFIFIPQLKQWKAFEEENQTIRRMAKYFSTPNKSFHTQYGEEENCH    281 - 350
PRGEKSSMERLLTEKNAVIESLQEQVNNAKEKIVRLMSAECTYDLPEGAAPPASSPNKDVQAVASVHTLA    351 - 420
AAQGPSGHLSDFQNDPGMAARDSQCTSGPSSYAQSLEGPGKDSSFSPGKEEKISDSKDFSDHLDSGCSQK    421 - 490
PWTEQSLGPERGDQVPMNPSQSLLPERGGSDPQRQRHLENSEEPPERRSRVSSVIREKLQEVLQDLGLGP    491 - 560
EASLSTAPSCHQQTWKNSAAFSPQKMPLSKELGFSPYMVRRRRAAQRARSHFPGSAPSSVGHRANRTVPG    561 - 630
AHSRLHVQNGDSPSLAPQTTDSRVRRPSSRKPSLPSDPQDRPGTLEGSKQSQTEPEGARGSKAAFLRQPS    631 - 700
GSGRAPSPAAPCLSKASPDLPEQWQLWPPVPSGCASLSSQHSYFDTESSSSDEFFCRCHRPYCEICFQSS    701 - 770
SDSSDSGTSDTDPEPTGGLASWEKLWARSKPIVNFKDDLKPTLV                              771 - 814
//

Text Mined References (7)

PMID Year Title
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12591167 2003 Molecular cloning and characterisation of a novel GABAB-related G-protein coupled receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.