Property Summary

NCBI Gene PubMed Count 32
Grant Count 24
R01 Count 21
Funding $5,192,962.89
PubMed Score 29.81
PubTator Score 145.94

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

Gene RIF (22)

PMID Text
25808990 IL17RD negatively regulates Toll-like receptor (TLR)-induced responses.
25118304 Demonstrate SEF expression in a healthy ovary during folliculogenesis and suggest hormonal regulation of its expression may be an important factor involved in intra-ovarian control mechanisms.
24681741 Downregulation of Dusp6, Sprouty4, and Sef--negative modulators of FGF2/ERK1/2 signaling--was present in eutopic endometria of adenomyosis, which may play critical roles in the development of adenomyosis.
23770285 These results reveal Sef-S actives Lys63-linked TAK1 polyubiquitination on lysine 209, induces TAK1-mediated JNK and p38 activation and also results apoptosis in 293T cells.
23643382 FGF17 and IL17RD prpopsed as the two top candidates in the entire proteome on the basis of a statistical test of their protein-protein interaction patterns to proteins known to be altered in congenital hypogonadotropic hypogonadism.
23169297 Downregulation of SEF mRNA is associated with prostate cancer.
23047677 Orphan receptor IL-17RD tunes IL-17A signalling and is required for neutrophilia.
22975329 This study establishes Sef as a feedback antagonist of proinflammatory cytokines and highlights its potential to regulate the crosstalk between proinflammatory cytokine receptors and receptor tyrosine kinases.
22335910 The expression of hSef is decreased in epithelial ovarian carcinoma tissue, but the expression of FGF-2 is increased.
22298595 Findings indicate that Ras-induced nuclear accumulation of activated MEK1/2 was reliant on downregulation of the spatial regulator Sef.
More...

AA Sequence

MAPWLQLCSVFFTVNACLNGSQLAVAAGGSGRARGADTCGWRGVGPASRNSGLYNITFKYDNCTTYLNPV      1 - 70
GKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSF     71 - 140
KRTGMESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQH    141 - 210
GSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKRKTCKQEQTTETTSCLLQNVSPGDYIIELVDDTNTTR    211 - 280
KVMHYALKPVHSPWAGPIRAVAITVPLVVISAFATLFTVMCRKKQQENIYSHLDEESSESSTYTAALPRE    281 - 350
RLRPRPKVFLCYSSKDGQNHMNVVQCFAYFLQDFCGCEVALDLWEDFSLCREGQREWVIQKIHESQFIIV    351 - 420
VCSKGMKYFVDKKNYKHKGGGRGSGKGELFLVAVSAIAEKLRQAKQSSSAALSKFIAVYFDYSCEGDVPG    421 - 490
ILDLSTKYRLMDNLPQLCSHLHSRDHGLQEPGQHTRQGSRRNYFRSKSGRSLYVAICNMHQFIDEEPDWF    491 - 560
EKQFVPFHPPPLRYREPVLEKFDSGLVLNDVMCKPGPESDFCLKVEAAVLGATGPADSQHESQHGGLDQD    561 - 630
GEARPALDGSAALQPLLHTVKAGSPSDMPRDSGIYDSSVPSSELSLPLMEGLSTDQTETSSLTESVSSSS    631 - 700
GLGEEEPPALPSKLLSSGSCKADLGCRSYTDELHAVAPL                                   701 - 739
//

Text Mined References (33)

PMID Year Title
25808990 2015 Orphan receptor IL-17RD regulates Toll-like receptor signalling via SEFIR/TIR interactions.
25118304 2014 Expression and regulation of the tumor suppressor, SEF, during folliculogenesis in humans and mice.
24681741 2014 Loss of expressions of Dusp6, Sprouty4, and Sef, negative regulators of FGF2/ERK1/2 signaling, in the endometrium of women with adenomyosis.
23770285 2013 Activation of TAK1 by Sef-S induces apoptosis in 293T cells.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
23169297 2013 Evidence for downregulation of the negative regulator SPRED2 in clinical prostate cancer.
23047677 2012 Orphan receptor IL-17RD tunes IL-17A signalling and is required for neutrophilia.
22975329 2012 Sef is an inhibitor of proinflammatory cytokine signaling, acting by cytoplasmic sequestration of NF-?B.
22335910 2011 [Expression of hSef and FGF-2 in epithelial ovarian tumor].
22298595 2012 Sef downregulation by Ras causes MEK1/2 to become aberrantly nuclear localized leading to polyploidy and neoplastic transformation.
More...