Property Summary

NCBI Gene PubMed Count 35
PubMed Score 31.48
PubTator Score 145.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 0.7
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count
Kallmann syndrome 33

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.800 4.0e-02
atypical teratoid / rhabdoid tumor 2.800 2.6e-06
autosomal dominant Emery-Dreifuss muscul... 1.033 4.1e-03
Breast cancer -2.100 1.3e-07
breast carcinoma -1.800 6.9e-26
ependymoma 2.000 6.6e-12
fibroadenoma 1.600 4.3e-02
glioblastoma 1.600 5.0e-07
intraductal papillary-mucinous adenoma (... -1.800 2.0e-02
invasive ductal carcinoma -1.262 2.6e-04
non-small cell lung cancer 1.013 1.7e-06
oligodendroglioma 1.500 7.1e-13
ovarian cancer -1.400 3.1e-02
pediatric high grade glioma 1.500 2.5e-04
primitive neuroectodermal tumor 1.400 8.4e-04
sonic hedgehog group medulloblastoma 1.600 2.6e-03
subependymal giant cell astrocytoma 1.960 1.1e-02

 GO Process (1)

Protein-protein Interaction (4)

Gene RIF (24)

AA Sequence

MAPWLQLCSVFFTVNACLNGSQLAVAAGGSGRARGADTCGWRGVGPASRNSGLYNITFKYDNCTTYLNPV      1 - 70
GKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSF     71 - 140
KRTGMESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQH    141 - 210
GSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKRKTCKQEQTTETTSCLLQNVSPGDYIIELVDDTNTTR    211 - 280
KVMHYALKPVHSPWAGPIRAVAITVPLVVISAFATLFTVMCRKKQQENIYSHLDEESSESSTYTAALPRE    281 - 350
RLRPRPKVFLCYSSKDGQNHMNVVQCFAYFLQDFCGCEVALDLWEDFSLCREGQREWVIQKIHESQFIIV    351 - 420
VCSKGMKYFVDKKNYKHKGGGRGSGKGELFLVAVSAIAEKLRQAKQSSSAALSKFIAVYFDYSCEGDVPG    421 - 490
ILDLSTKYRLMDNLPQLCSHLHSRDHGLQEPGQHTRQGSRRNYFRSKSGRSLYVAICNMHQFIDEEPDWF    491 - 560
EKQFVPFHPPPLRYREPVLEKFDSGLVLNDVMCKPGPESDFCLKVEAAVLGATGPADSQHESQHGGLDQD    561 - 630
GEARPALDGSAALQPLLHTVKAGSPSDMPRDSGIYDSSVPSSELSLPLMEGLSTDQTETSSLTESVSSSS    631 - 700
GLGEEEPPALPSKLLSSGSCKADLGCRSYTDELHAVAPL                                   701 - 739
//

Text Mined References (35)

PMID Year Title