Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.07
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.322 3.9e-05
astrocytic glioma -1.200 1.3e-02
Astrocytoma, Pilocytic 2.700 7.3e-08
glioblastoma 1.200 6.2e-03
nasopharyngeal carcinoma -2.300 3.9e-10
non-small cell lung cancer -1.033 3.9e-08
oligodendroglioma -1.100 2.2e-02
osteosarcoma -2.344 5.1e-04
ovarian cancer -1.400 4.0e-04
pituitary cancer 1.100 5.4e-05
tuberculosis -1.300 8.4e-03

 IMPC Phenotype (2)

Gene RIF (2)

AA Sequence

MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAA      1 - 70
PTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVV     71 - 140
KSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQWGFLD    141 - 210
TFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDN    211 - 280
KYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTF    281 - 350
GISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL                       351 - 401
//

Text Mined References (7)

PMID Year Title