Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.15
PubTator Score 4.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 0.013
oligodendroglioma -1.100 0.022
osteosarcoma -2.809 0.000
glioblastoma 1.200 0.006
adrenocortical carcinoma -1.597 0.000
tuberculosis -1.500 0.011
non-small cell lung cancer -1.350 0.000
pilocytic astrocytoma 3.100 0.000
nasopharyngeal carcinoma -2.600 0.000
ovarian cancer -1.600 0.000
pituitary cancer 1.200 0.001

Synonym

Accession Q8NFL0 B3KWY4 B7WNP0 BGnT-7
Symbols beta3GnT7

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
24418929 The nude mice xenograft model demonstrated that ectopic expression of the B3GNT7 gene in colon cancer cells diminished the migration capability and the liver-metastasis potential, respectively, of colon cancer cells.
17690104 sulfated keratan sulfate is produced by beta3GNT7, beta4GalT4, CGn6ST, and KSG6ST

AA Sequence

MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAA      1 - 70
PTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVV     71 - 140
KSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQWGFLD    141 - 210
TFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDN    211 - 280
KYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTF    281 - 350
GISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL                       351 - 401
//

Text Mined References (7)

PMID Year Title
24418929 2014 Suppression of B3GNT7 gene expression in colon adenocarcinoma and its potential effect in the metastasis of colon cancer cells.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
17690104 2007 Enzymes responsible for synthesis of corneal keratan sulfate glycosaminoglycans.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14706853 2004 beta1,3-N-Acetylglucosaminyltransferase-7 (beta3Gn-T7) acts efficiently on keratan sulfate-related glycans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12061784 2002 A novel beta1,3-N-acetylglucosaminyltransferase involved in invasion of cancer cells as assayed in vitro.