Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.69
PubTator Score 20.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.200 1.7e-03
psoriasis -1.400 2.6e-40

Synonym

Accession Q8NFK1 A4D296 Q86XI9
Symbols CX29
GJE1
CX30.2
CX31.3

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHP      1 - 70
LSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQ     71 - 140
LGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLEL    141 - 210
VLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA     211 - 279
//

Text Mined References (15)

PMID Year Title