Property Summary

NCBI Gene PubMed Count 7
PubMed Score 950.67
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

 GO Component (1)

Gene RIF (1)

AA Sequence

MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADP      1 - 70
EGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAE     71 - 140
SSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSS    141 - 210
GSSGGGGGSGSGSGGSSSSSSSSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKL    211 - 280
SKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFS    281 - 350
AGLPPAASCPEKCALFNSVSSSLCKQCTEKP                                           351 - 381
//

Text Mined References (7)

PMID Year Title