Property Summary

NCBI Gene PubMed Count 7
PubMed Score 859.39
PubTator Score 12.62

Knowledge Summary


No data available


  Disease Sources (2)



Accession Q8NFJ8 bHLHe22
Symbols Beta3


PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

 GO Component (1)

Gene RIF (1)

12213201 Segregates with Duane syndrome. Brain-specific expression with the highest abundance in the cerebellum.

AA Sequence

AGLPPAASCPEKCALFNSVSSSLCKQCTEKP                                           351 - 381

Text Mined References (7)

PMID Year Title
18557763 2008 Phylogenetic and expression analysis of the basic helix-loop-helix transcription factor gene family: genomic approach to cellular differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12617822 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213201 2002 Functional and structural characterization of the human gene BHLHB5, encoding a basic helix-loop-helix transcription factor.
9225980 1997 cDNAs with long CAG trinucleotide repeats from human brain.