Property Summary

NCBI Gene PubMed Count 7
PubMed Score 950.67
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession Q8NFJ8 bHLHe22
Symbols Beta3
BHLHB5
Beta3a
CAGL85
TNRC20

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 GO Component (1)

Gene RIF (1)

AA Sequence

MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADP      1 - 70
EGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAE     71 - 140
SSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSS    141 - 210
GSSGGGGGSGSGSGGSSSSSSSSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKL    211 - 280
SKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFS    281 - 350
AGLPPAASCPEKCALFNSVSSSLCKQCTEKP                                           351 - 381
//

Text Mined References (7)

PMID Year Title