Property Summary

NCBI Gene PubMed Count 49
Grant Count 24
R01 Count 8
Funding $1,440,163.7
PubMed Score 42.72
PubTator Score 68.90

Knowledge Summary

Patent (14,366)

Gene RIF (47)

PMID Text
26956854 PROKR2 may play a role in susceptibility of pituitary stalk interruption syndrome
26574895 Data suggest that prokineticins (PROK1 and PROK2) and prokineticin receptors (PROKR1 and PROKR2) act as main regulators of physiological functions of ovary, uterus, placenta, and testis. [REVIEW]
26192875 PROKR2 expression in human fetal ovary remained unchanged throughout gestation.
26047640 EG-VEGF, BV8, and PROKR2 gene expression is approximately five, four, and two times higher in cystic fibrosis lungs compared with controls.
25449422 PKR2 protomers form type II dimers involving TMs 4 and 5, with a role for TM5 in modulation of PKR2 function.
25064403 Study corroborates the clinical relevance of the EG-VEGF system in human early pregnancy, and provides evidence for the gene-gene interactions of EG-VEGF and PROKR variants.
24830383 Wild-type PROKR2 activates different G-protein subtypes (Gq, Gs, and Gi/o) and recruits beta-arrestins. The effects of 9 missense mutations on these 2 processes showed that some mutations affected both or only one of them.
24509228 PK2-induced PKR2 endocytosis is GRK2- and clathrin-dependent, but beta-arrestin-independent.
24487590 TSHZ1 is a key regulator of mammalian olfactory bulb development and function and controls the expression of PROKR2.
24276467 Single PROKR2 missense allelic variants can either affect both cAMP and IP signaling pathways differently or selectively.
More...

AA Sequence

MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIG      1 - 70
NFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLY     71 - 140
VSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQ    141 - 210
IWPVDQQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCI    211 - 280
LTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLL    281 - 350
HWRPSQRGSKSSADLDLRTNGVPTTEEVDCIRLK                                        351 - 384
//

Text Mined References (52)

PMID Year Title
26956854 2016 Correlation between Pituitary Stalk Interruption Syndrome and Prokineticin Receptor 2 and Prokineticin 2 Mutations.
26574895 2015 Prokineticins in central and peripheral control of human reproduction.
26192875 2015 Prokineticin Ligands and Receptors Are Expressed in the Human Fetal Ovary and Regulate Germ Cell Expression of COX2.
26047640 2015 EG-VEGF, BV8, and their receptor expression in human bronchi and their modification in cystic fibrosis: Impact of CFTR mutation (delF508).
25449422 2015 Identification of transmembrane domains that regulate spatial arrangements and activity of prokineticin receptor 2 dimers.
25077900 2014 The prevalence of CHD7 missense versus truncating mutations is higher in patients with Kallmann syndrome than in typical CHARGE patients.
25064403 2014 Gene-gene interactions and risk of recurrent miscarriages in carriers of endocrine gland-derived vascular endothelial growth factor and prokineticin receptor polymorphisms.
24830383 2014 Biased signaling through G-protein-coupled PROKR2 receptors harboring missense mutations.
24509228 2014 Mechanisms that underlie the internalization and extracellular signal regulated kinase 1/2 activation by PKR2 receptor.
24487590 2014 TSHZ1-dependent gene regulation is essential for olfactory bulb development and olfaction.
More...