Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.65
PubTator Score 29.19

Knowledge Summary

Patent (13,444)

TINX Plot

  Disease Sources (2)

Disease Target Count
Rheumatoid Arthritis 1171
Disease Target Count P-value
lung carcinoma 2844 8.52745076769901E-52
breast carcinoma 1614 4.39186066200704E-28
non-small cell lung cancer 2798 3.44654065923826E-18
malignant mesothelioma 3163 2.30753549300791E-8
tuberculosis and treatment for 3 months 327 2.28875284712291E-7
pancreatic cancer 2300 5.08944381905339E-7
lung cancer 4473 1.32333110606638E-6
nasopharyngeal carcinoma 1056 9.32025339260394E-6
lung adenocarcinoma 2714 1.04901073507595E-4
invasive ductal carcinoma 2950 4.6854662946916E-4
posterior fossa group A ependymoma 1511 5.8385916391806E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00128513225714217
glioblastoma 5572 0.00185293264295468
psoriasis 6685 0.00261602770546088
pediatric high grade glioma 2712 0.00471344511000283
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00549312946573603
active ulcerative colitis 477 0.00738560810546826
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00761930335533066
non-inflammatory breast cancer 208 0.00957691712599607
colon cancer 1475 0.0101988789126477
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0163518335793604
esophageal adenocarcinoma 737 0.0176010007179145
group 3 medulloblastoma 2254 0.0356808115675801
Barrett's esophagus 185 0.037698627046244
gastric carcinoma 832 0.04156167840011
spina bifida 1064 0.0434735772898587
ductal carcinoma in situ 1745 0.0457154332569081
chronic rhinosinusitis 512 0.0498733638464151

Expression

Synonym

Accession Q8NFJ5 B3KV45 O95357
Symbols RAI3
TIG1
RAIG1
GPCR5A
PEIG-1

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

 CSPA Cell Line (2)

Gene RIF (12)

PMID Text
25744720 Results show how GPRC5A deficiency leads to dysregulated EGFR and STAT3 signaling and lung tumorigenesis.
25311788 EGFR interacted with GPRC5A and phosphorylated it in two conserved double-tyrosine motifs, Y317/Y320 and Y347/ Y350, at the C-terminal tail of GPRC5A.
24984703 The interaction of miR-103a-3p with each of the two 5' UTR targets reduces the expression levels of both GPRC5A mRNA and GPRC5A protein in one normal epithelial and two pancreatic cancer cell lines.
24470238 Data indicate that in mammary tumors, the mRNA expression of GPRC5A significantly correlated with that of BRCA1.
23632812 RAI3 may contribute to the malignant progression of hepatocellular carcinoma
23154545 Decreased GPRC5A expression is associated with non-small cell lung cancers and lung inflammation.
20563252 Loss of GPRC5A is associated with lung adenocarcinomas.
19552806 analysis of RAI3 expression in normal and cancerous human breast tissue at both the mRNA and protein levels
19279407 Mechanisms underlying the induction of the putative human tumor suppressor GPRC5A are reported.
18000218 Gprc5a functions as a tumor suppressor in mouse lung, and human GPRC5A may share this property.
More...

AA Sequence

MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL      1 - 70
FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG     71 - 140
FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG    141 - 210
AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE    211 - 280
DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY    281 - 350
EVKKEGS                                                                   351 - 357
//

Text Mined References (34)

PMID Year Title
25744720 2015 Lung Tumor Suppressor GPRC5A Binds EGFR and Restrains Its Effector Signaling.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25311788 2014 EGFR phosphorylates and inhibits lung tumor suppressor GPRC5A in lung cancer.
24984703 2014 MiR-103a-3p targets the 5' UTR of GPRC5A in pancreatic cells.
24470238 2014 High prevalence of GPRC5A germline mutations in BRCA1-mutant breast cancer patients.
23632812 2014 Overexpression of retinoic acid-induced protein 3 predicts poor prognosis for hepatocellular carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154545 2012 G-protein coupled receptor family C, group 5, member A (GPRC5A) expression is decreased in the adjacent field and normal bronchial epithelia of patients with chronic obstructive pulmonary disease and non-small-cell lung cancer.
More...