Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.65
PubTator Score 29.19

Knowledge Summary

Patent (13,444)

Expression

Synonym

Accession Q8NFJ5 B3KV45 O95357
Symbols RAI3
TIG1
RAIG1
GPCR5A
PEIG-1

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (12)

PMID Text
25744720 Results show how GPRC5A deficiency leads to dysregulated EGFR and STAT3 signaling and lung tumorigenesis.
25311788 EGFR interacted with GPRC5A and phosphorylated it in two conserved double-tyrosine motifs, Y317/Y320 and Y347/ Y350, at the C-terminal tail of GPRC5A.
24984703 The interaction of miR-103a-3p with each of the two 5' UTR targets reduces the expression levels of both GPRC5A mRNA and GPRC5A protein in one normal epithelial and two pancreatic cancer cell lines.
24470238 Data indicate that in mammary tumors, the mRNA expression of GPRC5A significantly correlated with that of BRCA1.
23632812 RAI3 may contribute to the malignant progression of hepatocellular carcinoma
23154545 Decreased GPRC5A expression is associated with non-small cell lung cancers and lung inflammation.
20563252 Loss of GPRC5A is associated with lung adenocarcinomas.
19552806 analysis of RAI3 expression in normal and cancerous human breast tissue at both the mRNA and protein levels
19279407 Mechanisms underlying the induction of the putative human tumor suppressor GPRC5A are reported.
18000218 Gprc5a functions as a tumor suppressor in mouse lung, and human GPRC5A may share this property.
More...

AA Sequence

MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL      1 - 70
FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG     71 - 140
FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG    141 - 210
AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE    211 - 280
DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY    281 - 350
EVKKEGS                                                                   351 - 357
//

Text Mined References (34)

PMID Year Title
25744720 2015 Lung Tumor Suppressor GPRC5A Binds EGFR and Restrains Its Effector Signaling.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25311788 2014 EGFR phosphorylates and inhibits lung tumor suppressor GPRC5A in lung cancer.
24984703 2014 MiR-103a-3p targets the 5' UTR of GPRC5A in pancreatic cells.
24470238 2014 High prevalence of GPRC5A germline mutations in BRCA1-mutant breast cancer patients.
23632812 2014 Overexpression of retinoic acid-induced protein 3 predicts poor prognosis for hepatocellular carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154545 2012 G-protein coupled receptor family C, group 5, member A (GPRC5A) expression is decreased in the adjacent field and normal bronchial epithelia of patients with chronic obstructive pulmonary disease and non-small-cell lung cancer.
More...