Property Summary

NCBI Gene PubMed Count 35
PubMed Score 37.73
PubTator Score 29.19

Knowledge Summary

Patent (13,444)

Expression

  Differential Expression (28)

Disease log2 FC p
active ulcerative colitis 2.080 7.4e-03
adult high grade glioma 1.100 3.3e-03
Barrett's esophagus 2.100 3.8e-02
Breast cancer 2.300 1.6e-09
breast carcinoma 1.100 4.8e-03
chronic rhinosinusitis -1.279 5.0e-02
colon cancer 1.700 1.0e-02
ductal carcinoma in situ 1.900 4.6e-02
esophageal adenocarcinoma 1.800 2.3e-02
gastric carcinoma 2.600 4.2e-02
glioblastoma 1.300 1.9e-03
group 3 medulloblastoma -1.100 3.6e-02
intraductal papillary-mucinous adenoma (... 2.900 7.6e-03
intraductal papillary-mucinous carcinoma... 2.900 1.6e-02
intraductal papillary-mucinous neoplasm ... 4.700 5.5e-03
invasive ductal carcinoma 3.300 4.7e-04
lung adenocarcinoma -1.200 2.0e-06
lung cancer -6.800 1.3e-06
lung carcinoma -4.600 8.5e-52
malignant mesothelioma -2.100 2.3e-08
nasopharyngeal carcinoma -1.600 9.3e-06
non-small cell lung cancer -2.386 7.8e-16
pancreatic cancer 3.300 5.1e-07
pancreatic ductal adenocarcinoma liver m... 4.098 1.3e-03
posterior fossa group A ependymoma 1.200 5.8e-04
psoriasis -1.900 2.6e-03
spina bifida -1.872 4.3e-02
tuberculosis -2.500 2.9e-07

 CSPA Cell Line (2)

Gene RIF (19)

AA Sequence

MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL      1 - 70
FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG     71 - 140
FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG    141 - 210
AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE    211 - 280
DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY    281 - 350
EVKKEGS                                                                   351 - 357
//

Text Mined References (41)

PMID Year Title