Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.48
PubTator Score 16.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
23803043 downregulation of REPS2 may contribute to malignant progression of esophageal squamous cell carcinoma and represent a novel prognostic marker and a potential therapeutic target for esophageal squamous cell carcinoma patients.
23741527 The N36(L8)C34 region (amino acids 29-155) of HIV-1 gp41 binds the C-terminal region (amino acids 462-521; C60) of POB1 protein. The C60 peptide inhibits gp41-mediated membrane fusion and HIV-1 infection
19776672 REPS2 may be a useful tumor marker for favorable prognosis in breast cancer.
18474607 Hsf-1 causes specific and saturable inhibition of the transport activity of Ralbp1 and that the combination of Hsf-1 and POB1 causes nearly complete inhibition through specific bindings with Ralbp1.
15707977 These results show for the first time that POB1 can regulate the transport function of RLIP76 and are consistent with our previous studies showing that inhibition of RLIP76 induces apoptosis in cancer cells.
15455380 Decreased REPS2 expression is associated with androgen-independent state of advanced prostate cancer
15184881 decreased expression of REPS2 might be a key factor, causing prostate cancer cells to become resistant to induction of apoptosis by androgen deprivation.
12771942 POB1, through its influence on the Ral signalling pathway, is involved in growth factor signalling and consequently in control of cell proliferation
12149250 These results suggest that POB1 interacts with PAG2 through its proline-rich motif, thereby regulating cell migration.

AA Sequence

MEAAAAAAAAAAAAAAAGGGCGSGPPPLLLSEGEQQCYSELFARCAGAAGGGPGSGPPEAARVAPGTATA      1 - 70
AAGPVADLFRASQLPAETLHQITELCGAKRVGYFGPTQFYIALKLIAAAQSGLPVRIESIKCELPLPRFM     71 - 140
MSKNDGEIRFGNPAELHGTKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPLSH    141 - 210
GYSKLRSSAEQMHPAPYEARQPLVQPEGSSSGGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITE    211 - 280
EQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVAR    281 - 350
KNGYPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDV    351 - 420
TSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSR    421 - 490
ASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVSEAELLPQLSRAPSQAAESSPAKKDVLYSQ    491 - 560
PPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQKQSSKQKKAIQTAIRKNKEANAVLARLN    561 - 630
SELQQQLKEVHQERIALENQLEQLRPVTVL                                            631 - 660
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23803043 2013 Expression and clinical significance of REPS2 in human esophageal squamous cell carcinoma.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
19776672 2009 TMEM25, REPS2 and Meis 1: favourable prognostic and predictive biomarkers for breast cancer.
18647389 2008 The central proline rich region of POB1/REPS2 plays a regulatory role in epidermal growth factor receptor endocytosis by binding to 14-3-3 and SH3 domain-containing proteins.
18474607 2008 Hsf-1 and POB1 induce drug sensitivity and apoptosis by inhibiting Ralbp1.
18154663 2007 Binding to DPF-motif by the POB1 EH domain is responsible for POB1-Eps15 interaction.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15707977 2005 POB1 over-expression inhibits RLIP76-mediated transport of glutathione-conjugates, drugs and promotes apoptosis.
More...