Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.31
PubTator Score 16.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 2.159 1.3e-05
adult high grade glioma -3.100 3.1e-08
aldosterone-producing adenoma -1.200 1.6e-02
astrocytic glioma -1.500 1.5e-02
Astrocytoma, Pilocytic -1.900 2.5e-06
atypical teratoid / rhabdoid tumor -4.300 8.7e-10
Breast cancer 1.100 4.3e-04
breast carcinoma 1.300 9.8e-19
cystic fibrosis -1.200 6.1e-03
ependymoma -2.900 1.5e-02
glioblastoma -3.000 8.9e-09
group 3 medulloblastoma -3.000 3.3e-06
interstitial cystitis -1.200 1.0e-03
intraductal papillary-mucinous adenoma (... 1.300 2.4e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.4e-03
invasive ductal carcinoma 1.300 5.0e-03
lung adenocarcinoma -1.300 5.1e-14
lung cancer -1.300 8.8e-03
medulloblastoma, large-cell -3.800 2.0e-06
non primary Sjogren syndrome sicca -1.100 2.2e-02
non-small cell lung cancer -1.317 1.8e-13
oligodendroglioma -1.300 3.0e-02
osteosarcoma -3.015 1.2e-06
ovarian cancer -1.100 2.0e-03
Pick disease -1.900 8.5e-03
pituitary cancer -1.100 4.0e-05
primitive neuroectodermal tumor -3.200 3.6e-05
psoriasis -1.100 6.9e-03
subependymal giant cell astrocytoma -1.061 1.3e-02

Gene RIF (10)

AA Sequence

MEAAAAAAAAAAAAAAAGGGCGSGPPPLLLSEGEQQCYSELFARCAGAAGGGPGSGPPEAARVAPGTATA      1 - 70
AAGPVADLFRASQLPAETLHQITELCGAKRVGYFGPTQFYIALKLIAAAQSGLPVRIESIKCELPLPRFM     71 - 140
MSKNDGEIRFGNPAELHGTKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPLSH    141 - 210
GYSKLRSSAEQMHPAPYEARQPLVQPEGSSSGGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITE    211 - 280
EQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVAR    281 - 350
KNGYPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDV    351 - 420
TSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSR    421 - 490
ASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVSEAELLPQLSRAPSQAAESSPAKKDVLYSQ    491 - 560
PPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQKQSSKQKKAIQTAIRKNKEANAVLARLN    561 - 630
SELQQQLKEVHQERIALENQLEQLRPVTVL                                            631 - 660
//

Text Mined References (22)

PMID Year Title