Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.48
PubTator Score 16.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
breast carcinoma 1614 9.81451583648951E-19
posterior fossa group A ependymoma 1511 2.20976614962484E-18
astrocytoma 1493 1.00217848811694E-14
lung adenocarcinoma 2714 5.11631467348271E-14
non-small cell lung cancer 2798 1.80034232088812E-13
oligodendroglioma 2849 6.98948892883633E-11
atypical teratoid / rhabdoid tumor 4369 8.67822147612651E-10
medulloblastoma 1524 3.70317265919171E-9
pediatric high grade glioma 2712 1.68008626430116E-8
osteosarcoma 7933 1.40963993572849E-7
glioblastoma 5572 5.57178102138667E-7
medulloblastoma, large-cell 6234 1.967645587808E-6
pilocytic astrocytoma 3086 2.79632088882303E-6
acute quadriplegic myopathy 1157 1.28806169044372E-5
interstitial cystitis 2299 1.58078798200227E-5
primitive neuroectodermal tumor 3031 3.63005522838545E-5
pituitary cancer 1972 4.04424324618109E-5
lung cancer 4473 6.4842209840412E-5
Breast cancer 3099 4.28366181234349E-4
ovarian cancer 8492 0.00203660595902762
subependymal giant cell astrocytoma 2287 0.00209855145295619
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00238485474093232
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00338537181648921
invasive ductal carcinoma 2950 0.00503223993289879
cystic fibrosis 1670 0.00606883401296665
psoriasis 6685 0.00691389909715992
Pick disease 1893 0.0084640262744675
aldosterone-producing adenoma 664 0.0159024647740575
non primary Sjogren syndrome sicca 840 0.0224401710854489

Expression

Synonym

Accession Q8NFH8 A6PWZ6 O43428 Q5JNZ8 Q8NFI5
Symbols POB1

Gene

PDB

1IQ3  

  Ortholog (11)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (9)

PMID Text
23803043 downregulation of REPS2 may contribute to malignant progression of esophageal squamous cell carcinoma and represent a novel prognostic marker and a potential therapeutic target for esophageal squamous cell carcinoma patients.
23741527 The N36(L8)C34 region (amino acids 29-155) of HIV-1 gp41 binds the C-terminal region (amino acids 462-521; C60) of POB1 protein. The C60 peptide inhibits gp41-mediated membrane fusion and HIV-1 infection
19776672 REPS2 may be a useful tumor marker for favorable prognosis in breast cancer.
18474607 Hsf-1 causes specific and saturable inhibition of the transport activity of Ralbp1 and that the combination of Hsf-1 and POB1 causes nearly complete inhibition through specific bindings with Ralbp1.
15707977 These results show for the first time that POB1 can regulate the transport function of RLIP76 and are consistent with our previous studies showing that inhibition of RLIP76 induces apoptosis in cancer cells.
15455380 Decreased REPS2 expression is associated with androgen-independent state of advanced prostate cancer
15184881 decreased expression of REPS2 might be a key factor, causing prostate cancer cells to become resistant to induction of apoptosis by androgen deprivation.
12771942 POB1, through its influence on the Ral signalling pathway, is involved in growth factor signalling and consequently in control of cell proliferation
12149250 These results suggest that POB1 interacts with PAG2 through its proline-rich motif, thereby regulating cell migration.

AA Sequence

MEAAAAAAAAAAAAAAAGGGCGSGPPPLLLSEGEQQCYSELFARCAGAAGGGPGSGPPEAARVAPGTATA      1 - 70
AAGPVADLFRASQLPAETLHQITELCGAKRVGYFGPTQFYIALKLIAAAQSGLPVRIESIKCELPLPRFM     71 - 140
MSKNDGEIRFGNPAELHGTKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPLSH    141 - 210
GYSKLRSSAEQMHPAPYEARQPLVQPEGSSSGGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITE    211 - 280
EQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVAR    281 - 350
KNGYPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDV    351 - 420
TSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSR    421 - 490
ASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVSEAELLPQLSRAPSQAAESSPAKKDVLYSQ    491 - 560
PPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQKQSSKQKKAIQTAIRKNKEANAVLARLN    561 - 630
SELQQQLKEVHQERIALENQLEQLRPVTVL                                            631 - 660
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23803043 2013 Expression and clinical significance of REPS2 in human esophageal squamous cell carcinoma.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
19776672 2009 TMEM25, REPS2 and Meis 1: favourable prognostic and predictive biomarkers for breast cancer.
18647389 2008 The central proline rich region of POB1/REPS2 plays a regulatory role in epidermal growth factor receptor endocytosis by binding to 14-3-3 and SH3 domain-containing proteins.
18474607 2008 Hsf-1 and POB1 induce drug sensitivity and apoptosis by inhibiting Ralbp1.
18154663 2007 Binding to DPF-motif by the POB1 EH domain is responsible for POB1-Eps15 interaction.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15707977 2005 POB1 over-expression inhibits RLIP76-mediated transport of glutathione-conjugates, drugs and promotes apoptosis.
More...