Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.59
PubTator Score 11.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Intestinal pseudo-obstruction 12 3.922 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.189 3.2e-05
oligodendroglioma 1.200 1.4e-14
osteosarcoma 1.508 3.2e-03
sonic hedgehog group medulloblastoma 1.100 1.3e-02

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLA      1 - 70
GGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPA     71 - 140
SIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNW    141 - 210
MHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGST    211 - 280
PRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW                            281 - 326
//

Text Mined References (30)

PMID Year Title