Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.08
PubTator Score 11.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.37643947720462E-14
acute quadriplegic myopathy 1157 3.24618876445753E-5
osteosarcoma 7933 0.0032199774274077
sonic hedgehog group medulloblastoma 1482 0.0128053078151816
Disease Target Count Z-score Confidence
Intestinal pseudo-obstruction 8 3.909 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.200 0.000
osteosarcoma 1.508 0.003
acute quadriplegic myopathy 1.189 0.000
sonic hedgehog group medulloblastoma 1.100 0.013

Synonym

Accession Q8NFH5 B4DP57 B4DYB4 Q4ZFZ9 Q53S95 Q8TDJ1
Symbols MP44
NP44
MP-44
NUP53

Gene

PDB

4LIR  

  Ortholog (14)

Gene RIF (2)

PMID Text
20200978 Observational study of gene-disease association. (HuGE Navigator)
18256286 defined regions of Nup53 that bind to neighboring nucleoporins as well as those domains that target Nup53 to the nuclear pore complex.

AA Sequence

MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLA      1 - 70
GGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPA     71 - 140
SIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNW    141 - 210
MHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGST    211 - 280
PRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW                            281 - 326
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22960634 2012 Dimerization and direct membrane interaction of Nup53 contribute to nuclear pore complex assembly.
21444689 2011 System analysis shows distinct mechanisms and common principles of nuclear envelope protein dynamics.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...