Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.98
PubTator Score 96.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.600 2.7e-02
adult high grade glioma 1.200 2.9e-04
Astrocytoma, Pilocytic 1.300 2.1e-05
atypical teratoid / rhabdoid tumor 1.800 3.2e-07
ependymoma 1.800 6.3e-12
glioblastoma 1.900 4.8e-10
group 3 medulloblastoma 2.100 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.200 1.1e-02
lung cancer 2.400 9.0e-03
medulloblastoma, large-cell 1.400 3.2e-04
non-small cell lung cancer 1.149 1.6e-19
oligodendroglioma 1.100 7.3e-14
ovarian cancer -1.200 4.4e-03
primitive neuroectodermal tumor 1.700 4.8e-05
Waldenstrons macroglobulinemia 1.284 9.2e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEGIQYKTLRTFH      1 - 70
HGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEI     71 - 140
ASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLLAQQAILSLESEQVP    141 - 210
LMSAHWCLKNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQF    211 - 280
QIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV                            281 - 326
//

Text Mined References (12)

PMID Year Title