Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.97
PubTator Score 96.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NFH4 Q9H644 p37
Symbols p37

Gene

PANTHER Protein Class (1)

PDB

5A9Q  

 GWAS Trait (1)

Gene RIF (1)

PMID Text
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEGIQYKTLRTFH      1 - 70
HGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEI     71 - 140
ASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLLAQQAILSLESEQVP    141 - 210
LMSAHWCLKNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQF    211 - 280
QIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV                            281 - 326
//

Text Mined References (12)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17360435 2007 Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146057 2004 The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...