Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.46
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis 1.100 2.9e-04
group 3 medulloblastoma 1.400 2.4e-03
lung cancer 2.000 2.2e-05
malignant mesothelioma 1.200 5.8e-06
osteosarcoma -1.069 9.0e-04
ovarian cancer -1.200 7.6e-05
pancreatic ductal adenocarcinoma liver m... 1.407 2.1e-02
psoriasis -1.100 1.4e-06

Gene RIF (1)

AA Sequence

MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCD      1 - 70
IRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCN     71 - 140
NPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQI    141 - 210
LSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTC    211 - 280
SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRS    281 - 350
LSVNTLDVLGPCLVCGTDAEAIYVTRHLFS                                            351 - 380
//

Text Mined References (18)

PMID Year Title