Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.06
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -1.100 0.000
osteosarcoma 1.789 0.000
pancreatic ductal adenocarcinoma liver m... 1.407 0.021
lung cancer 2.000 0.000
group 3 medulloblastoma 1.400 0.002
ovarian cancer -1.200 0.000
dermatomyositis 1.100 0.000

Synonym

Accession Q8NFH3 B4E2F0 Q9H8S0
Symbols p42
bA350J20.1

Gene

PDB

5A9Q   4I79  

Gene RIF (1)

PMID Text
26391640 Data present the crystal structure of full length Nup43 and show that it adopts a canonical WD40 fold similar to other members of the family and interacts with Nup85-Seh1L complex to form a ternary complex.

AA Sequence

MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCD      1 - 70
IRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCN     71 - 140
NPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQI    141 - 210
LSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTC    211 - 280
SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRS    281 - 350
LSVNTLDVLGPCLVCGTDAEAIYVTRHLFS                                            351 - 380
//

Text Mined References (18)

PMID Year Title
26391640 2015 Crystal structure of human nuclear pore complex component NUP43.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17360435 2007 Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146057 2004 The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis.
More...