Property Summary

NCBI Gene PubMed Count 87
PubMed Score 412.47
PubTator Score 209.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 2.2e-02
Alzheimer's disease 1.300 1.6e-02
astrocytic glioma -1.300 4.7e-02
Astrocytoma, Pilocytic -1.100 3.2e-03
atypical teratoid / rhabdoid tumor -1.400 1.8e-04
ependymoma 1.200 2.7e-02
glioblastoma -1.700 6.0e-05
group 4 medulloblastoma -1.200 3.3e-03
malignant mesothelioma 1.200 1.7e-05
medulloblastoma, large-cell -1.800 4.4e-03
oligodendroglioma 1.400 8.1e-03
osteosarcoma -3.998 2.8e-07
Pick disease 1.300 3.0e-04
pituitary cancer -2.300 2.5e-05
primitive neuroectodermal tumor -1.300 7.5e-03
progressive supranuclear palsy 1.500 2.3e-02

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (71)

AA Sequence

MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAEGASVE      1 - 70
SSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGP     71 - 140
IFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINSWPFLLGKVRGIIDELQGKALKVFEA    141 - 210
EQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTE    211 - 280
DTLVQMEKLADLEEESESWDNSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLR    281 - 350
HMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL    351 - 420
SPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAAL    421 - 490
TNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKT    491 - 560
YKSHLMSTVRSPTASESRN                                                       561 - 579
//

Text Mined References (92)

PMID Year Title