Property Summary

NCBI Gene PubMed Count 10
PubMed Score 36.93
PubTator Score 27.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.200 2.1e-14
breast carcinoma 1.100 2.8e-19
colon cancer 1.200 7.8e-03
group 3 medulloblastoma 1.500 1.0e-03
lung cancer 1.100 3.4e-03
non-small cell lung cancer 1.140 6.1e-19

Gene RIF (3)

AA Sequence

MGWDLGTRLFQRQEQRSRLSRIWLEKTRVFLEGSTRTPALPHCLFWLLQVPSTQDPLFPGYGPQCPVDLA      1 - 70
GPPCLRPLFGGLGGYWRALQRGREGRTMTSRASELSPGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLR     71 - 140
SLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATK    141 - 210
ALGGEGWEKLSLVPSSARLHYGTDPCTGQPFRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFH    211 - 280
SKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGS    281 - 350
LVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAV    351 - 420
QRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRR    421 - 490
TDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALK    491 - 560
CLSPGGHPTYRPAYLLENEEEERNSRT                                               561 - 587
//

Text Mined References (21)

PMID Year Title