Property Summary

NCBI Gene PubMed Count 9
Grant Count 7
R01 Count 7
Funding $339,949.8
PubMed Score 34.11
PubTator Score 27.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
non-small cell lung cancer 1.140 0.000
colon cancer 1.200 0.008
lung cancer 1.200 0.003
group 3 medulloblastoma 1.600 0.000
breast carcinoma 1.100 0.000
Breast cancer 1.300 0.000

Gene RIF (2)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with flavin adenine dinucleotide synthetase homolog (FLAD1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19240958 Our data show that a reduction in electron transport proteins, namely FAD synthetase, RFK, CYC1, and SDHB, is seen in patients with ALS.

AA Sequence

MGWDLGTRLFQRQEQRSRLSRIWLEKTRVFLEGSTRTPALPHCLFWLLQVPSTQDPLFPGYGPQCPVDLA      1 - 70
GPPCLRPLFGGLGGYWRALQRGREGRTMTSRASELSPGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLR     71 - 140
SLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATK    141 - 210
ALGGEGWEKLSLVPSSARLHYGTDPCTGQPFRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFH    211 - 280
SKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGS    281 - 350
LVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAV    351 - 420
QRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRR    421 - 490
TDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALK    491 - 560
CLSPGGHPTYRPAYLLENEEEERNSRT                                               561 - 587
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20060505 2010 Mitochondrial localization of human FAD synthetase isoform 1.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19240958 2009 Specific electron transport chain abnormalities in amyotrophic lateral sclerosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...