Property Summary

NCBI Gene PubMed Count 21
PubMed Score 20.76
PubTator Score 12.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.700 5.3e-03
Astrocytoma, Pilocytic -2.300 1.6e-06
atypical teratoid / rhabdoid tumor -1.400 1.8e-02
ependymoma -1.300 5.5e-03
glioblastoma -2.100 1.5e-06
medulloblastoma -1.800 1.0e-03
medulloblastoma, large-cell -1.900 1.1e-02
osteosarcoma -3.650 2.4e-06
pituitary cancer -1.300 2.8e-03
primitive neuroectodermal tumor -1.600 3.9e-02
subependymal giant cell astrocytoma -1.460 2.5e-03
tuberculosis 2.900 2.7e-06

Gene RIF (16)

AA Sequence

MALRGTLRPLKVRRRREMLPQQVGFVCAVLALVCCASGLFGSLGHKTASASKRVLPDTWRNRKLMAPVNG      1 - 70
TQTAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICERLHLSEDVA     71 - 140
GATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVRLTWWAVCRDSVYY    141 - 210
TISVIVLIVFIYDEQIVWWEGLVLIILYVFYILIMKYNVKMQAFFTVKQKSIANGNPVNSELEAGNDFYD    211 - 280
GSYDDPSVPLLGQVKEKPQYGKNPVVMVDEIMSSSPPKFTFPEAGLRIMITNKFGPRTRLRMASRIIINE    281 - 350
RQRLINSANGVSSKPLQNGRHENIENGNVPVENPEDPQQNQEQQPPPQPPPPEPEPVEADFLSPFSVPEA    351 - 420
RGDKVKWVFTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGYTLGIPDVIMG    421 - 490
ITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGLQTMVVNYGSTVKINSRGLVY    491 - 560
SVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLCFSIMIEFNVFTFVNLPMCREDD            561 - 622
//

Text Mined References (23)

PMID Year Title