Knowledge Summary

Patent

No data available

Synonym

Accession Q8NFD4
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGGFGSRFWQEGVWDRDLEKSTRLEEDAMESEPLAGTKTRGRGRRRWEARHGWTLPAHASQPSPRTVVAT      1 - 70
ATGAEVSACAGRSAGTRVARPESQLSHLYGWDKYSNPRPSRRARAVARVHALEQAPILCRALRWGLTQFL     71 - 140
RGTSPVTQSVPFS                                                             141 - 153
//

Text Mined References (3)

PMID Year Title