Property Summary

NCBI Gene PubMed Count 114
Grant Count 26
Funding $1,888,061.56
PubMed Score 98.27
PubTator Score 112.62

Knowledge Summary

Patent (1,555)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (122)

PMID Text
27180960 We found no association between alcohol dependence and ANKK1 Taq 1A polymorphism
26970175 pattern of three Taq1 polymorphism of ANKK1 and DRD3 allele frequency, haplotypes and linkage disequilibrium was examined in five Punjabi ethnic groups
26664790 Ankyrin repeat and kinase domain containing I (ANKK1) and dopamine D2 receptor (DRD2) genes associated with psychopathic traits. We hypothesized that cognitive phenomena are associated with Taq IA SNP of the ANKK1 gene and with C957T SNP of DRD2.
26624925 The Taq1A polymorphism (dbSNP rs1800497), located ~9.5 kb downstream from DRD2 and in exon 8 of ANKK1 has been associated with smoking behavior.
26501178 Results revealed a significant interaction effect of BDNF Val66Met polymorphism and ANKK1 gene (DRD2 Taq1a/ANKK1 polymorphism) on loss aversion
26114114 These results support an association between ANKK1 and LTA genetic markers and vulnerability to schizophrenia and show the potential influence of just one copy of the mutant C or G allele in the Egyptian population.
26110876 The DRD2/ANKK1 TaqIA polymorphism might contribute to TS susceptibility.
25931179 Cognitive performance after traumatic brain injury is moderated by ANKK1 genetic variation.
25740917 The genotypic association of LEPR rs1137101, the allelic association of LEPR rs1137101, and ANKK1 rs1800497 with weight gain remained significant in epilepsy patients receiving valproic Acid.
25684044 the DRD2/ANKK1 Taq1A (rs1800497) SNP does not present contributions to the development of AD.
More...

AA Sequence

MAADPTELRLGSLPVFTRDDFEGDWRLVASGGFSQVFQARHRRWRTEYAIKCAPCLPPDAASSDVNYLIE      1 - 70
EAAKMKKIKFQHIVSIYGVCKQPLGIVMEFMANGSLEKVLSTHSLCWKLRFRIIHETSLAMNFLHSIKPP     71 - 140
LLHLDLKPGNILLDSNMHVKISDFGLSKWMEQSTRMQYIERSALRGMLSYIPPEMFLESNKAPGPKYDVY    141 - 210
SFAIVIWELLTQKKPYSGFNMMMIIIRVAAGMRPSLQPVSDQWPSEAQQMVDLMKRCWDQDPKKRPCFLD    211 - 280
ITIETDILLSLLQSRVAVPESKALARKVSCKLSLRQPGEVNEDISQELMDSDSGNYLKRALQLSDRKNLV    281 - 350
PRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGAD    351 - 420
ANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLH    421 - 490
EAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSG    491 - 560
YGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPL    561 - 630
HLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAA    631 - 700
LKGNTAILKVLVEAGAQLDVQDGVSCTPLQLALRSRKQGIMSFLEGKEPSVATLGGSKPGAEMEI         701 - 765
//

Text Mined References (115)

PMID Year Title
27180960 2016 Case control study of ANKK1 Taq 1A polymorphism in patients with alcohol dependence classified according to Lesch's typology.
26970175 2016 Analysis of ANKKI (rs1800497) and DRD2 (rs1079597, rs1800498) variants in five ethnic groups from Punjab, North-West India.
26664790 2015 The ANKK1/DRD2 locus is a genomic substrate for affective priming and recognition of angry faces.
26624925 2015 The significant association of Taq1A genotypes in DRD2/ANKK1 with smoking cessation in a large-scale meta-analysis of Caucasian populations.
26501178 2015 On the genetics of loss aversion: An interaction effect of BDNF Val66Met and DRD2/ANKK1 Taq1a.
26114114 2015 Association between ANKK1 (rs1800497) and LTA (rs909253) Genetic Variants and Risk of Schizophrenia.
26110876 2015 Association between DRD2/ANKK1 TaqIA Polymorphism and Susceptibility with Tourette Syndrome: A Meta-Analysis.
25931179 Posttraumatic Brain Injury Cognitive Performance Is Moderated by Variation Within ANKK1 and DRD2 Genes.
25740917 2015 Association of LEPR and ANKK1 Gene Polymorphisms with Weight Gain in Epilepsy Patients Receiving Valproic Acid.
25684044 2015 Association study of the SLC6A3 VNTR (DAT) and DRD2/ANKK1 Taq1A polymorphisms with alcohol dependence in a population from northeastern Brazil.
More...