Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 8
Funding $1,961,640.9
PubMed Score 24.26
PubTator Score 32.15

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
15525354 The mouse ee3 is an orphan G-protein-coupled receptor with potential connections to erythropoietin and 5HT2a receptor signalling. ee3_2, a similar gene, is also described, along with human orthologs.
12806492 Observational study of genetic testing. (HuGE Navigator)
12404111 Transcriptionally silenced in a normal individual with a FRAXF CGG full mutation (fragile site).

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVGTGVWARNPQ      1 - 70
YRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSL     71 - 140
ELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSMDVIAEQRRTH    141 - 210
ITMALSWMTIVVPLLTFEILLVHKLDGHNAFSSIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQ    211 - 280
FLLEIFPFLREYGNISYDLHHEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD    281 - 350
//

Text Mined References (16)

PMID Year Title
20969748 2010 Identification of differentially expressed genes using an annealing control primer system in stage III serous ovarian carcinoma.
18078840 2008 Human chromosome fragility.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15525354 2004 Cloning of a novel neuronally expressed orphan G-protein-coupled receptor which is up-regulated by erythropoietin, interacts with microtubule-associated protein 1b and colocalizes with the 5-hydroxytryptamine 2a receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12806492 2003 Genetic and neurological evaluation in a sample of individuals with pervasive developmental disorders.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12404111 2002 A novel gene, FAM11A, associated with the FRAXF CpG island is transcriptionally silent in FRAXF full mutation.
More...