Property Summary

NCBI Gene PubMed Count 15
PubMed Score 28.24
PubTator Score 32.15

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NFB2 B3KTZ3 Q3SYH1 Q96CW3 Q96KE8
Symbols ee3
FRAXF
FAM11A
CXorf13

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 IMPC Phenotype (1)

Gene RIF (3)

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVGTGVWARNPQ      1 - 70
YRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSL     71 - 140
ELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSMDVIAEQRRTH    141 - 210
ITMALSWMTIVVPLLTFEILLVHKLDGHNAFSSIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQ    211 - 280
FLLEIFPFLREYGNISYDLHHEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD    281 - 350
//

Text Mined References (16)

PMID Year Title