Property Summary

NCBI Gene PubMed Count 29
PubMed Score 21.22
PubTator Score 24.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.9e-05
adult high grade glioma 3801 9.5e-05
glioblastoma 5792 1.7e-04
Breast cancer 3578 3.3e-03
Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 3.521 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 9.5e-05
Breast cancer 1.100 3.3e-03
glioblastoma -1.100 1.7e-04
medulloblastoma, large-cell -1.100 3.9e-05

Synonym

Accession Q8NFA2 Q86YM1 Q8NFA3 Q96B73
Symbols SNX28
P41NOX
P41NOXA
P41NOXB
P41NOXC
SH3PXD5

Gene

PDB

2L73  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEAGLLRRSDRVL      1 - 70
PKLLGQASLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLDLEPALPPGSR     71 - 140
VILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR    141 - 210
QTAWFPAPYLEEAAPGQGREGGPSLGSSGPQFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYG    211 - 280
DRAGLLPAVLLRPEGLGALLSGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRR    281 - 350
ALERRPRRQGRPRGCVDSVPHPTTEQ                                                351 - 376
//

Text Mined References (30)

PMID Year Title