Property Summary

NCBI Gene PubMed Count 28
Grant Count 18
R01 Count 18
Funding $1,100,693.73
PubMed Score 19.04
PubTator Score 24.11

Knowledge Summary

Patent

No data available

Gene RIF (12)

PMID Text
23975421 TNF-alpha/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
23957209 Phosphorylation of Thr341 allows Noxo1 to sufficiently interact with Noxa1, an interaction that participates in Nox1 activation
23322165 Phorbol myristate acetate stimulates NOXO1 phosphorylation in a transfected human embryonic kidney (HEK) 293 epithelial cell model via protein kinase C and identify Ser-154 as the major phosphorylated site.
22342885 Surface plasmon resonance experiments identify PtdIns(4,5)P(2) and PtdIns(3,4,5)P(3) as preferred targets of NOXO1beta PX.
21188560 The backbone assignments of NOXO1beta PX are studied using NMR.
20454568 The first quantitative characterization of the interactions made between the cytosolic regulators NOXO1 and NOXA1 and membrane-bound p22(phox), is presented.
17126813 These findings suggest that Nox activation involves a conformational change leading to disruption of the bis-SH3-PRR interaction in Noxo1.
16911517 This study shows the expression of alternatively spliced transcripts of the NOXO1 gene and the roles of the protein products in the activation of Nox oxidases.
16329988 These results suggest that the formation of the complex consisting of Nox1, betaPix, and NoxO1 is likely to be a critical step in EGF-induced ROS generation.
15949904 Data suggest different tissue localizations and functions for NOXO1beta and NOXO1gamma in regulating Nox family members.
More...

AA Sequence

MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEAGLLRRSDRVL      1 - 70
PKLLGQASLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLDLEPALPPGSR     71 - 140
VILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR    141 - 210
QTAWFPAPYLEEAAPGQGREGGPSLGSSGPQFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYG    211 - 280
DRAGLLPAVLLRPEGLGALLSGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRR    281 - 350
ALERRPRRQGRPRGCVDSVPHPTTEQ                                                351 - 376
//

Text Mined References (29)

PMID Year Title
23975421 2014 TNF-?/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
23957209 2013 Phosphorylation of Noxo1 at threonine 341 regulates its interaction with Noxa1 and the superoxide-producing activity of Nox1.
23322165 2013 NOXO1 phosphorylation on serine 154 is critical for optimal NADPH oxidase 1 assembly and activation.
22547655 2012 HSP90 inhibition by 17-DMAG attenuates oxidative stress in experimental atherosclerosis.
22342885 2012 The NOXO1? PX domain preferentially targets PtdIns(4,5)P2 and PtdIns(3,4,5)P3.
21188560 2011 Backbone 1H, 15N, and 13C resonance assignments for the NOXO1? PX domain.
20609497 Direct interaction between Tks proteins and the N-terminal proline-rich region (PRR) of NoxA1 mediates Nox1-dependent ROS generation.
20454568 2010 Regulation of NOXO1 activity through reversible interactions with p22 and NOXA1.
19755710 2009 Novel p47(phox)-related organizers regulate localized NADPH oxidase 1 (Nox1) activity.
18037128 2007 Evidence for cancer-associated expression of NADPH oxidase 1 (Nox1)-based oxidase system in the human stomach.
More...