Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.48
PubTator Score 2.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.600 0.000
tuberculosis and treatment for 6 months -1.200 0.000
Pick disease 1.100 0.000
ovarian cancer -2.200 0.000

Gene RIF (1)

PMID Text
18369653 ZNF397, a new class of interphase to early prophase-specific, SCAN-zinc-finger, mammalian centromere protein.

AA Sequence

MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQETPGPREALSR      1 - 70
LQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEEAVTLLEDLEREFDDPGQQVP     71 - 140
ASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPCLSPKSDCENSETATKEGISEEKSQGLPQEP    141 - 210
SFRGISEHESNLVWKQGSATGEKLRSPSQGGSFSQVIFTNKSLGKRDLYDEAERCLILTTDSIMCQKVPP    211 - 280
EERPYRCDVCGHSFKQHSSLTQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAF    281 - 350
NQSSALIRHRKIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT    351 - 420
GERPYECNECGKAFRQSSELITHQRIHSGEKPYECSECGKAFSLSSNLIRHQRIHSGEEPYQCNECGKTF    421 - 490
KRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLMRHQRVHTIK                              491 - 534
//

Text Mined References (11)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18369653 2008 ZNF397, a new class of interphase to early prophase-specific, SCAN-zinc-finger, mammalian centromere protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12801647 2003 Identification and characterization of two novel human SCAN domain-containing zinc finger genes ZNF396 and ZNF397.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...