Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.48
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 9.4151606788918E-11
tuberculosis and treatment for 6 months 686 1.12854970085186E-4
Pick disease 1893 1.20729825422456E-4
group 3 medulloblastoma 2254 2.36093910562025E-4
Disease Target Count Z-score Confidence
Alopecia 55 3.046 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.600 0.000
tuberculosis and treatment for 6 months -1.200 0.000
Pick disease 1.100 0.000
ovarian cancer -2.200 0.000

Synonym

Accession Q8NF99 Q9BRM2
Symbols ZNF47
ZSCAN15

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG

Gene RIF (1)

PMID Text
18369653 ZNF397, a new class of interphase to early prophase-specific, SCAN-zinc-finger, mammalian centromere protein.

AA Sequence

MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQETPGPREALSR      1 - 70
LQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEEAVTLLEDLEREFDDPGQQVP     71 - 140
ASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPCLSPKSDCENSETATKEGISEEKSQGLPQEP    141 - 210
SFRGISEHESNLVWKQGSATGEKLRSPSQGGSFSQVIFTNKSLGKRDLYDEAERCLILTTDSIMCQKVPP    211 - 280
EERPYRCDVCGHSFKQHSSLTQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAF    281 - 350
NQSSALIRHRKIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT    351 - 420
GERPYECNECGKAFRQSSELITHQRIHSGEKPYECSECGKAFSLSSNLIRHQRIHSGEEPYQCNECGKTF    421 - 490
KRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLMRHQRVHTIK                              491 - 534
//

Text Mined References (11)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18369653 2008 ZNF397, a new class of interphase to early prophase-specific, SCAN-zinc-finger, mammalian centromere protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12801647 2003 Identification and characterization of two novel human SCAN domain-containing zinc finger genes ZNF396 and ZNF397.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...