Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.48
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 9.4e-11
tuberculosis and treatment for 6 months 409 1.1e-04
Pick disease 1894 1.2e-04
group 3 medulloblastoma 4104 7.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alopecia 115 3.077 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.500 7.9e-03
ovarian cancer -2.200 9.4e-11
Pick disease 1.100 1.2e-04
tuberculosis and treatment for 6 months -1.200 1.1e-04

Gene RIF (1)

AA Sequence

MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQETPGPREALSR      1 - 70
LQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEEAVTLLEDLEREFDDPGQQVP     71 - 140
ASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPCLSPKSDCENSETATKEGISEEKSQGLPQEP    141 - 210
SFRGISEHESNLVWKQGSATGEKLRSPSQGGSFSQVIFTNKSLGKRDLYDEAERCLILTTDSIMCQKVPP    211 - 280
EERPYRCDVCGHSFKQHSSLTQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAF    281 - 350
NQSSALIRHRKIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT    351 - 420
GERPYECNECGKAFRQSSELITHQRIHSGEKPYECSECGKAFSLSSNLIRHQRIHSGEEPYQCNECGKTF    421 - 490
KRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLMRHQRVHTIK                              491 - 534
//

Text Mined References (12)

PMID Year Title