Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.12267141117255E-8
osteosarcoma 7933 3.28547571886046E-7
medulloblastoma, large-cell 6234 1.34472574726362E-5
group 3 medulloblastoma 2254 0.0271320983549743

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.661 0.000
medulloblastoma, large-cell 1.100 0.000
group 3 medulloblastoma -1.100 0.027
ovarian cancer 1.800 0.000

Gene RIF (1)

PMID Text
12795636 highly expressed in spleen and moderately expressed in intestine, colon, lung and brain

AA Sequence

MRGVSCLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQ      1 - 70
WVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSA     71 - 140
RVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIV    141 - 210
LPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQARVSF    211 - 280
//

Text Mined References (4)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12795636 2003 A novel serine protease predominately expressed in macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.