Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.100 2.7e-02
medulloblastoma, large-cell 1.100 1.3e-05
osteosarcoma -3.661 3.3e-07
ovarian cancer 1.800 1.1e-08

Gene RIF (1)

AA Sequence

MRGVSCLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQ      1 - 70
WVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSA     71 - 140
RVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIV    141 - 210
LPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQARVSF    211 - 280
//

Text Mined References (4)

PMID Year Title