Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NF67
Symbols

 Compartment GO Term (0)

AA Sequence

MKEMYENAEDKVNNSTGKWSCVEERICHLQHENPCIEQQLDDVHQKEDHKEIVTNIQRGFIESGKKDLML      1 - 70
EEKNKKLMNECDHLKESLFQYEREKAERVVVVRQLQQEAADSLKKLTMLESPLEGISHYHINLDETQVPK     71 - 140
KKLFQVESQFDDLMVEKEAVSSKCVNLAKENQVFQQKLLSMKKVQQECEKLEEDKKMLEEEILNLKTHME    141 - 210
NSMVELSKLQEYKSELDERAMQAVEKLEEIHLQEQAQYKKQLEQLNKDIIQLH                     211 - 263
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.