Property Summary

NCBI Gene PubMed Count 26
Grant Count 14
R01 Count 8
Funding $1,126,965.66
PubMed Score 34.89
PubTator Score 39.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26260533 No disease causing mutations in the LPCAT1 gene were identified, indicating that LPCAT1 either does not confer a genetic predisposition to retinitis pigmentosa, or incidence of mutations in LPCAT1 is particularly rare in patients with retinitis pigmentosa.
25803864 Down-regulation of LPCAT1 resulted in a decreased intercellular platelet-activating factor concentration and PAFR expression.
25752890 Overexpression of Lysophosphatidylcholine Acyltransferase 1 and Concomitant Lipid Alterations are associated with Gastric Cancer
25683484 LPCAT1 is an independent predictor of early tumor recurrence of breast carcinoma and represents a novel prognostic biomarker that reflects underlying biological alterations
24418166 LPCAT1, a gene involved in the remodeling of phospholipids, was nominally associated with incident SCA risk.
23941784 The prognostic impact of LPCAT1 expression was independent of histological and clinical parameters. It is concluded, that LPCAT1 measurement, either alone or in combination, may be utilized for better clinical decision-making.
23567080 effect of LPCAT1 overexpression or knockdown on cell proliferation, migration, and invasion in hepatocellular carcinoma cell lines
22101258 LPCAT1 correlates with the progression of prostate cancer.
21498505 LPCAT1 and -2 have, in addition to their known function in specialized cells, a ubiquitous role in LD-associated lipid metabolism
20407208 full LPCAT1 activity is required to achieve the levels of SatPC essential for the transition to air breathing
More...

AA Sequence

MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWP      1 - 70
LALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFD     71 - 140
AIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGT    141 - 210
CTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPS    211 - 280
EEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEK    281 - 350
DLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT    351 - 420
IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEY    421 - 490
LYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD                              491 - 534
//

Text Mined References (31)

PMID Year Title
27582510 2016 Lysophosphatidylcholine acyltransferase 1 is downregulated by hepatitis C virus: impact on production of lipo-viro-particles.
26260533 2015 Molecular screening of the LPCAT1 gene in patients with retinitis pigmentosa without defined mutations in known retinitis pigmentosa genes.
25968427 2016 Amniotic fluid LPCAT1 mRNA correlates with the lamellar body count.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25803864 2015 Lysophosphatidylcholine acyltransferase1 overexpression promotes oral squamous cell carcinoma progression via enhanced biosynthesis of platelet-activating factor.
25752890 2016 Overexpression of Lysophosphatidylcholine Acyltransferase 1 and Concomitant Lipid Alterations in Gastric Cancer.
25683484 2015 Lysophosphatidylcholine acyltransferase 1 (LPCAT1) upregulation in breast carcinoma contributes to tumor progression and predicts early tumor recurrence.
25491198 2014 Two different pathways of phosphatidylcholine synthesis, the Kennedy Pathway and the Lands Cycle, differentially regulate cellular triacylglycerol storage.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24418166 2014 Common variation in fatty acid metabolic genes and risk of incident sudden cardiac arrest.
More...