Property Summary

NCBI Gene PubMed Count 26
PubMed Score 36.85
PubTator Score 39.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 3.774 4.2e-05
active ulcerative colitis 3.662 7.1e-04
Breast cancer 1.100 2.3e-06
esophageal adenocarcinoma 1.200 1.9e-02
gastric carcinoma 2.500 8.0e-03
glioblastoma 1.400 1.7e-02
group 3 medulloblastoma 1.800 1.5e-04
intraductal papillary-mucinous adenoma (... 1.300 5.8e-03
intraductal papillary-mucinous carcinoma... 1.700 2.4e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.7e-02
invasive ductal carcinoma 1.100 2.7e-02
lung cancer -1.800 1.2e-04
lung carcinoma -1.900 3.0e-23
non-small cell lung cancer -1.265 2.8e-07
osteosarcoma -1.012 2.0e-02
ovarian cancer 2.100 4.3e-08
pancreatic ductal adenocarcinoma liver m... 1.050 3.4e-02
pediatric high grade glioma 1.100 6.7e-04
psoriasis -1.100 8.5e-04

Protein-protein Interaction (4)

Gene RIF (14)

AA Sequence

MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWP      1 - 70
LALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFD     71 - 140
AIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGT    141 - 210
CTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPS    211 - 280
EEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEK    281 - 350
DLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT    351 - 420
IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEY    421 - 490
LYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD                              491 - 534
//

Text Mined References (31)

PMID Year Title