Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.30
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NEZ5 Q0D2P8 Q6PIL5 Q8IXW3 Q9H824 Q9UKC0
Symbols FBX22
FISTC1

Gene

Gene RIF (5)

PMID Text
26868148 Results indicate that SCF(Fbxo22)-KDM4A is an E3 ubiquitin ligase that targets methylated p53 and regulates key senescent processes.
26087183 Authors demonstrate that F-box only protein 22 (FBXO22) interacts with and thereby destabilizes KLF4 via polyubiquitination. As a result, FBXO22 could promote HCC cells proliferation.
25336657 FBXO22 protein is required for optimal synthesis of NMDA receptor coagonist D-serine by interacting with serine racemase, activating it, and preventing its targeting to membranes.
22761574 we determined that the phage-encoded GogB effector protein in Salmonella targets the host SCF E3 type ubiquitin ligase through an interaction with Skp1 and the human F-box only 22 (FBXO22) protein
21768309 FBXO22 is a key regulator of histone methylation marks, namely, H3K9 and H3K36 methylation, through the regulation of KDM4A protein levels.

AA Sequence

MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWIS      1 - 70
AGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFP     71 - 140
KQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVG    141 - 210
LLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSF    211 - 280
SGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFP    281 - 350
SVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK                     351 - 403
//

Text Mined References (25)

PMID Year Title
26868148 2016 SCF(Fbxo22)-KDM4A targets methylated p53 for degradation and regulates senescence.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26087183 2015 F-box protein FBXO22 mediates polyubiquitination and degradation of KLF4 to promote hepatocellular carcinoma progression.
25336657 2014 FBXO22 protein is required for optimal synthesis of the N-methyl-D-aspartate (NMDA) receptor coagonist D-serine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22972877 2012 F-box and leucine-rich repeat protein 22 is a cardiac-enriched F-box protein that regulates sarcomeric protein turnover and is essential for maintenance of contractile function in vivo.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22761574 2012 GogB is an anti-inflammatory effector that limits tissue damage during Salmonella infection through interaction with human FBXO22 and Skp1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21768309 2011 SCF(FBXO22) regulates histone H3 lysine 9 and 36 methylation levels by targeting histone demethylase KDM4A for ubiquitin-mediated proteasomal degradation.
More...