Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.69
PubTator Score 7.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.038 5.0e-07
ovarian cancer -1.100 1.2e-03
progressive supranuclear palsy -1.100 1.2e-02
tuberculosis -1.200 7.6e-05

 GWAS Trait (2)

Protein-protein Interaction (5)

Gene RIF (8)

AA Sequence

MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINNLTININILLP      1 - 70
PQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYL     71 - 140
YSNPSGMSPYASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLPIPTVD    141 - 210
ASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELA    211 - 280
RKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAE    281 - 350
DFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL                           351 - 397
//

Text Mined References (28)

PMID Year Title