Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.10
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.038 0.000
tuberculosis and treatment for 3 months -1.500 0.000
progressive supranuclear palsy -1.100 0.012
ovarian cancer -1.500 0.001

Synonym

Accession Q8NEZ2 Q336D5 Q6NW27 Q8N3D7 Q8TBL7 Q96DL9 hVps37A
Symbols HCRP1
PQBP2
SPG53

Gene

Gene RIF (6)

PMID Text
22891969 Low HCRP1 expression was found to be of adverse prognostic significance in patients with oral and oropharyngeal squamous cell carcinoma who received preoperative chemoradiotherapy
22717650 The missense mutation c.1146A>T in Vps37A causes autosomal recessive complex hereditary spastic paraparesis.
22016507 Data show hVps37A mRNA downregulation in ovarian cancer.
18005716 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
15240819 HCRP1 is a subunit of mammalian ESCRT-I, and its function is essential for lysosomal sorting of EGF receptors.
14623289 Our results strongly suggest that HCRP1 might be a growth inhibitory protein and associated with decreasing the invasion of HCC cells

AA Sequence

MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINNLTININILLP      1 - 70
PQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYL     71 - 140
YSNPSGMSPYASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLPIPTVD    141 - 210
ASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELA    211 - 280
RKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAE    281 - 350
DFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL                           351 - 397
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22891969 2013 HCRP1 expression status is a significant prognostic marker in oral and oropharyngeal cancer.
22717650 2012 A founder mutation in Vps37A causes autosomal recessive complex hereditary spastic paraparesis.
22016507 2011 hVps37A Status affects prognosis and cetuximab sensitivity in ovarian cancer.
21757351 2011 UBAP1 is a component of an endosome-specific ESCRT-I complex that is essential for MVB sorting.
21269460 2011 Initial characterization of the human central proteome.
20654576 2010 Distinct functions of human MVB12A and MVB12B in the ESCRT-I dependent on their posttranslational modifications.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
More...