Property Summary

NCBI Gene PubMed Count 23
PubMed Score 2.12
PubTator Score 3.93

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.4579547852323E-12
acute quadriplegic myopathy 1157 1.78356272269399E-6
ovarian cancer 8492 6.49678952061217E-5
group 3 medulloblastoma 2254 0.034581962139297
Disease Target Count Z-score Confidence
Intrahepatic cholangiocarcinoma 1 3.013 1.5


  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.336 0.000
acute quadriplegic myopathy 1.448 0.000
group 3 medulloblastoma 1.100 0.035
ovarian cancer -1.200 0.000


Accession Q8NEY8 E9PAX8 Q86YT2 Q8IXN3 Q8TB09 Q96NB9 Q9NXL4 Q9P0P6 Q9P0R9
Symbols CR


  Ortholog (11)

 MGI Term (1)

Gene RIF (6)

26022416 this study identified the HUSH (human silencing hub) complex, comprising three poorly characterized proteins, TASOR, MPP8, and periphilin; this complex is absent from Drosophila but is conserved from fish to humans.
25608663 analysis of FGFR2-PPHLN1 fusion and ARAF mutations in intrahepatic cholangiocarcinoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19730898 Data show that periphilin displays an overlapping expression pattern with synphilin-1 in cellular and animal models and in Lewy bodies of Parkinson's disease (PD) patients, and support involvement of periphilin in PD.
15474462 CR (periphilin) retards S-phase progression by modifying expression of Cdc7 and other genes involved in progression of DNA replication
12853457 periphilin is potentially involved in epithelial differentiation and contributes to epidermal integrity and barrier formation

AA Sequence

ERILLRTQTPFTPENLFLAMLSVVHCNSRKDVKPENKQ                                    421 - 458

Text Mined References (37)

PMID Year Title
26022416 2015 GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25608663 2015 Massive parallel sequencing uncovers actionable FGFR2-PPHLN1 fusion and ARAF mutations in intrahepatic cholangiocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.