Property Summary

NCBI Gene PubMed Count 24
PubMed Score 2.26
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.5e-12
acute quadriplegic myopathy 1158 1.8e-06
ovarian cancer 8520 6.5e-05
group 3 medulloblastoma 4104 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Ichthyosis 56 3.014 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.448 1.8e-06
group 3 medulloblastoma 1.100 3.5e-02
juvenile dermatomyositis 1.336 1.5e-12
ovarian cancer -1.200 6.5e-05

Gene RIF (7)

AA Sequence

MWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDRPGEGSYNRYYSHVDYRDYDEGRSFSHD      1 - 70
RRSGPPHRGDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYARERSPYKRDNTFFRESPVGRKDS     71 - 140
PHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYKRQNEGNPERDKERPVQSLKTSRDTSPSSGS    141 - 210
AVSSSKVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIE    211 - 280
LFEDSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIESAGQTWQQ    281 - 350
VPPVRNTEMDHDGTPENEGEETAQSAPQPPQAPQPLQPRKKRVRRTTQLRRTTGAPDITWGMLKKTTQEA    351 - 420
ERILLRTQTPFTPENLFLAMLSVVHCNSRKDVKPENKQ                                    421 - 458
//

Text Mined References (39)

PMID Year Title