Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
R01 Count 3
Funding $306,471.5
PubMed Score 8.56
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.869 0.000
periodontitis -1.600 0.000
primary Sjogren syndrome -2.400 0.001
psoriasis 1.300 0.000
non-small cell lung carcinoma 1.200 0.000
spina bifida -2.128 0.039
Breast cancer 1.100 0.003
pituitary cancer -1.500 0.000
chronic rhinosinusitis -1.445 0.013

Synonym

Accession Q8NEY4 Q96EL8 V-ATPase subunit C 2
Symbols VMA5
ATP6C2

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRR      1 - 70
MAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTA     71 - 140
AYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPR    141 - 210
STKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYQTSCV    211 - 280
ALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVE    281 - 350
SVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFH    351 - 420
IDLSLLD                                                                   421 - 427
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21356312 2011 Expression, purification and characterization of isoforms of peripheral stalk subunits of human V-ATPase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20093472 2010 Requirement of prorenin receptor and vacuolar H+-ATPase-mediated acidification for Wnt signaling.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17897319 2007 Integral and associated lysosomal membrane proteins.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
More...