Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.10
PubTator Score 2.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.100 2.9e-03
chronic rhinosinusitis -1.445 1.3e-02
non-small cell lung carcinoma 1.200 1.3e-08
osteosarcoma -1.869 2.5e-06
periodontitis -1.600 1.3e-31
pituitary cancer -1.300 2.6e-03
primary Sjogren syndrome -2.400 1.4e-03
psoriasis 1.100 2.7e-14
spina bifida -2.128 3.9e-02

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRR      1 - 70
MAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTA     71 - 140
AYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPR    141 - 210
STKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYQTSCV    211 - 280
ALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVE    281 - 350
SVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFH    351 - 420
IDLSLLD                                                                   421 - 427
//

Text Mined References (22)

PMID Year Title