Property Summary

NCBI Gene PubMed Count 14
PubMed Score 120.06
PubTator Score 81.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Alzheimer's disease 1.200 2.2e-02
astrocytic glioma 1.600 2.4e-03
Astrocytoma, Pilocytic 1.500 1.6e-06
atypical teratoid / rhabdoid tumor -2.000 2.4e-04
Breast cancer 1.300 5.7e-07
ependymoma 1.500 4.0e-02
glioblastoma 1.100 3.4e-03
interstitial lung disease 1.100 9.6e-03
lung adenocarcinoma 1.300 2.4e-04
lung carcinoma 1.100 1.8e-13
medulloblastoma -1.200 2.4e-03
medulloblastoma, large-cell -1.600 2.2e-03
non-small cell lung cancer 1.147 6.2e-09
oligodendroglioma 1.700 3.1e-02
osteosarcoma 1.679 1.7e-04
ovarian cancer -1.300 2.6e-06
pancreatic cancer 1.200 1.2e-02
Pick disease 1.800 4.0e-07
primary pancreatic ductal adenocarcinoma 1.231 1.2e-02

Gene RIF (3)

AA Sequence

MLGSSVKSVQPEVELSSGGGDEGADEPRGAGRKAAAADGRGMLPKRAKAPGGGGGMAKASAAELKVFKSG      1 - 70
SVDSRVPGGPPASNLRKQKSLTNLSFLTDSEKKLQLYEPEWSDDMAKAPKGLGKVGSKGREAPLMSKTLS     71 - 140
KSEHSLFQAKGSPAGGAKTPLAPLAPNLGKPSRIPRGPYAEVKPLSKAPEAAVSEDGKSDDELLSSKAKA    141 - 210
QKSSGPVPSAKGQEERAFLKVDPELVVTVLGDLEQLLFSQMLDPESQRKRTVQNVLDLRQNLEETMSSLR    211 - 280
GSQVTHSSLEMTCYDSDDANPRSVSSLSNRSSPLSWRYGQSSPRLQAGDAPSVGGSCRSEGTPAWYMHGE    281 - 350
RAHYSHTMPMRSPSKLSHISRLELVESLDSDEVDLKSGYMSDSDLMGKTMTEDDDITTGWDESSSISSGL    351 - 420
SDASDNLSSEEFNASSSLNSLPSTPTASRRNSTIVLRTDSEKRSLAESGLSWFSESEEKAPKKLEYDSGS    421 - 490
LKMEPGTSKWRRERPESCDDSSKGGELKKPISLGHPGSLKKGKTPPVAVTSPITHTAQSALKVAGKPEGK    491 - 560
ATDKGKLAVKNTGLQRSSSDAGRDRLSDAKKPPSGIARPSTSGSFGYKKPPPATGTATVMQTGGSATLSK    561 - 630
IQKSSGIPVKPVNGRKTSLDVSNSAEPGFLAPGARSNIQYRSLPRPAKSSSMSVTGGRGGPRPVSSSIDP    631 - 700
SLLSTKQGGLTPSRLKEPTKVASGRTTPAPVNQTDREKEKAKAKAVALDSDNISLKSIGSPESTPKNQAS    701 - 770
HPTATKLAELPPTPLRATAKSFVKPPSLANLDKVNSNSLDLPSSSDTTHASKVPDLHATSSASGGPLPSC    771 - 840
FTPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMPMSLPSAFPSSTPVPTPPAP    841 - 910
PAAPTEEETEELTWSGSPRAGQLDSNQRDRNTLPKKGLRYQLQSQEETKERRHSHTIGGLPESDDQSELP    911 - 980
SPPALPMSLSAKGQLTNIVSPTAATTPRITRSNSIPTHEAAFELYSGSQMGSTLSLAERPKGMIRSGSFR    981 - 1050
DPTDDVHGSVLSLASSASSTYSSAEERMQSEQIRKLRRELESSQEKVATLTSQLSANANLVAAFEQSLVN   1051 - 1120
MTSRLRHLAETAEEKDTELLDLRETIDFLKKKNSEAQAVIQGALNASETTPKELRIKRQNSSDSISSLNS   1121 - 1190
ITSHSSIGSSKDADAKKKKKKSWVYELRSSFNKAFSIKKGPKSASSYSDIEEIATPDSSAPSSPKLQHGS   1191 - 1260
TETASPSIKSSTSSSVGTDVTEGPAHPAPHTRLFHANEEEEPEKKEVSELRSELWEKEMKLTDIRLEALN   1261 - 1330
SAHQLDQLRETMHNMQLEVDLLKAENDRLKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLA   1331 - 1400
DTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYI   1401 - 1470
SKMDPASTLGLSTESIHGYSISHVKRVLDAEPPEMPPCRRGVNNISVSLKGLKEKCVDSLVFETLIPKPM   1471 - 1540
MQHYISLLLKHRRLVLSGPSGTGKTYLTNRLAEYLVERSGREVTEGIVSTFNMHQQSCKDLQLYLSNLAN   1541 - 1610
QIDRETGIGDVPLVILLDDLSEAGSISELVNGALTCKYHKCPYIIGTTNQPVKMTPNHGLHLSFRMLTFS   1611 - 1680
NNVEPANGFLVRYLRRKLVESDSDINANKEELLRVLDWVPKLWYHLHTFLEKHSTSDFLIGPCFFLSCPI   1681 - 1750
GIEDFRTWFIDLWNNSIIPYLQEGAKDGIKVHGQKAAWEDPVEWVRDTLPWPSAQQDQSKLYHLPPPTVG   1751 - 1820
PHSIASPPEDRTVKDSTPSSLDSDPLMAMLLKLQEAANYIESPDRETILDPNLQATL                1821 - 1877
//

Text Mined References (25)

PMID Year Title