Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $486,114
PubMed Score 39.10
PubTator Score 11.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Synonym

Accession Q8NEX9 B3KVB4
Symbols RDHS
SDRO
SDR-O

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (1)

PMID Text
23341893 SDR9C7 promotes esophageal squamous cell carcinoma metastasis partly through regulation of MMP11.

AA Sequence

MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTS      1 - 70
YRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEV     71 - 140
TLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIL    141 - 210
GKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPG    211 - 280
LDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV                                         281 - 313
//

Text Mined References (9)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23341893 2013 SDR9C7 promotes lymph node metastases in patients with esophageal squamous cell carcinoma.
19703561 2009 In search for function of two human orphan SDR enzymes: hydroxysteroid dehydrogenase like 2 (HSDL2) and short-chain dehydrogenase/reductase-orphan (SDR-O).
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234675 2002 SDR-O: an orphan short-chain dehydrogenase/reductase localized at mouse chromosome 10/human chromosome 12.