Property Summary

NCBI Gene PubMed Count 8
PubMed Score 44.87
PubTator Score 11.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 1.7e-35

Synonym

Accession Q8NEX9 B3KVB4
Symbols RDHS
SDRO
SDR-O
ARCI13

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTS      1 - 70
YRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEV     71 - 140
TLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIL    141 - 210
GKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPG    211 - 280
LDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV                                         281 - 313
//

Text Mined References (10)

PMID Year Title