Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NEX6 E1P624 Q5TGZ6
Symbols WAP11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MVSLMKLWIPMLMTFFCTVLLSVLGEMRKKRYDRKELLLEECWGKPNVKECTNKCSKAFRCKDKNYTCCW      1 - 70
TYCGNICWINVETSGDY                                                          71 - 87
//

Text Mined References (8)

PMID Year Title