Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVSLMKLWIPMLMTFFCTVLLSVLGEMRKKRYDRKELLLEECWGKPNVKECTNKCSKAFRCKDKNYTCCW      1 - 70
TYCGNICWINVETSGDY                                                          71 - 87
//

Text Mined References (8)

PMID Year Title
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.