Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
18976975 Knockdown of WAP four-disulfide core domain 9 (WFDC9) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MKPWILLLVMFISGVVMLLPVLGSFWNKDPFLDMIRETEQCWVQPPYKYCEKRCTKIMTCVRPNHTCCWT      1 - 70
YCGNICLDNEEPLKSMLNP                                                        71 - 89
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.