Property Summary

NCBI Gene PubMed Count 14
PubMed Score 22.02
PubTator Score 14.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 3.8e-03
atypical teratoid / rhabdoid tumor -1.500 7.3e-03
group 3 medulloblastoma -2.000 2.4e-03
medulloblastoma, large-cell -2.000 2.0e-04
pituitary cancer 1.200 3.1e-06

Gene RIF (7)

AA Sequence

MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSI      1 - 70
IITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKKDSVDTVAIK     71 - 140
VEEDEKNEAKKKKGEK                                                          141 - 156
//

Text Mined References (14)

PMID Year Title