Property Summary

NCBI Gene PubMed Count 21
PubMed Score 25.38
PubTator Score 5.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH      1 - 70
MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER     71 - 140
LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH    141 - 210
GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV    211 - 280
SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW    281 - 350
ILSQTHNIFTQAGVRQLYVQIDFAAM                                                351 - 376
//

Text Mined References (25)

PMID Year Title