Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.54
PubTator Score 5.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NEW0 B2R949 D3DT61 Q8TCH2 ZnT-7
Symbols ZNT7
ZnT-7
ZnTL2

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
23275032 Overexpression of ZnT7 is accompanied by activation of PI3K/Akt pathway and inhibiting HG-induced apoptosis.
22190034 HIV-1 IN is identified to have a physical interaction with solute carrier family 30 (zinc transporter), member 7 (SLC30A7; ZNT7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21462106 Intracellular transporters such as ZnT7, influence the transcellular movement of zinc across the enterocyte
19064571 Observational study of gene-disease association. (HuGE Navigator)
18639746 Data show that ZNT7 is extensively present in the Abeta-positive plaques in the cortex of human AD brains.
17971500 hZnT-7 is up-regulated in response to cellular zinc depletion in Raji & THP-1 cells.

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH      1 - 70
MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER     71 - 140
LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH    141 - 210
GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV    211 - 280
SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW    281 - 350
ILSQTHNIFTQAGVRQLYVQIDFAAM                                                351 - 376
//

Text Mined References (25)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275032 2013 Zinc transporter 5 and zinc transporter 7 induced by high glucose protects peritoneal mesothelial cells from undergoing apoptosis.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21462106 2010 Gastrointestinal factors influencing zinc absorption and homeostasis.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18639746 2008 Abundant expression of zinc transporters in the amyloid plaques of Alzheimer's disease brain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17971500 2008 Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...