Property Summary

NCBI Gene PubMed Count 201
PubMed Score 61.08
PubTator Score 290.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 1 43 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
inflammatory breast cancer 286 1.0e-02
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer -1.800 1.0e-02

Gene RIF (198)

AA Sequence

MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAE      1 - 70
SHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAM     71 - 140
RLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSL    141 - 210
ELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP                                         211 - 243
//

Text Mined References (204)

PMID Year Title