Property Summary

NCBI Gene PubMed Count 167
Grant Count 14
R01 Count 1
Funding $1,916,311.79
PubMed Score 57.98
PubTator Score 290.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non-inflammatory breast cancer -2.200 0.007

Gene RIF (165)

PMID Text
27349011 IL-27 gene rs153109 A/G SNP may be involved in susceptibility to BD in the Iranian population.
27049569 The Serum IL-27 levels were negatively correlated with neuromyelitis optica spectrum disorders severity and spinal cord lesion length.
26932661 IL-27 attenuates epithelial-mesenchymal transition in alveolar epithelial cells in the absence or presence of TGF-beta1 through the JAK/STAT and TGF-beta/Smad signalling pathways.
26872212 Serum IL-27 and IL-27-producing T cells, are involved in the pathogenesis of pemphigus.
26657115 IL-27 induced IDO or PD-L1 expression in monocytes and in human PC3 prostate and A549 lung cancer cells
26654512 It is biologically plausible that SNPs in IL-27 may have effect on individual susceptibility to pre-eclampsia.
26649511 Findings demonstrated that IL-27 and IL-27R were elevated in multiple sclerosis lesions and that local IL-27 can modulate immune properties of astrocytes and infiltrating immune cells
26648303 The level of interleukin 27 is increased in peripheral blood mononuclear cells of patients with rheumatoid arthritis or osteoarthritis.
26531704 This study suggests the possibility that IL-27 might contribute to Myasthenia gravis pathogenesis or immunoregulation.
26432006 This is the first report regarding the structural biology of IL27 accompanied by alteration at its genetic level and delving into the unknown residue-level and functional biochemistry for bringing about an annihilation towards AIDS.
More...

AA Sequence

MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAE      1 - 70
SHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAM     71 - 140
RLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSL    141 - 210
ELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP                                         211 - 243
//

Text Mined References (170)

PMID Year Title
27349011 2016 IL-27 Gene Polymorphisms in Iranian Patients with Behcet's Disease.
27049569 2016 Decreased serum IL-27 and IL-35 levels are associated with disease severity in neuromyelitis optica spectrum disorders.
26932661 2016 IL-27 inhibits the TGF-?1-induced epithelial-mesenchymal transition in alveolar epithelial cells.
26872212 2016 Increased Frequency of T Follicular Helper Cells and Elevated Interleukin-27 Plasma Levels in Patients with Pemphigus.
26657115 2015 IL-27 induces the expression of IDO and PD-L1 in human cancer cells.
26654512 2016 Association between polymorphisms in IL-27 gene and pre-eclampsia.
26649511 2016 Production of IL-27 in multiple sclerosis lesions by astrocytes and myeloid cells: Modulation of local immune responses.
26648303 2015 [An increased level of interleukin 27 in peripheral blood mononuclear cells and fibroblasts like synoviocytes of patients with rheumatoid arthritis or osteoarthritis].
26531704 2015 Serum interleukin-27 expression in patients with myasthenia gravis.
26432006 2016 Molecular modeling, mutational analysis and conformational switching in IL27: An in silico structural insight towards AIDS research.
More...