Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.39
PubTator Score 7.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 1.07911628641956E-38
periodontitis 269 8.62407458708667E-25
malignant mesothelioma 3163 9.42957909392413E-7
ulcerative colitis 2087 1.48036441008113E-6
pancreatic cancer 2300 1.09311099226694E-5
interstitial cystitis 2299 3.21882479460167E-5
nasopharyngeal carcinoma 1056 6.48360567614897E-5
Pick disease 1893 1.49093983753261E-4
pilocytic astrocytoma 3086 1.97611999998628E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.92733607501421E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.0651513344449E-4
psoriasis 6685 3.20975789978247E-4
pediatric high grade glioma 2712 4.17551843626176E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.28074546190549E-4
cutaneous lupus erythematosus 1056 0.00107052924902846
glioblastoma 5572 0.00209081626947042
osteosarcoma 7933 0.00297004940780707
lung cancer 4473 0.00342181781499132
group 4 medulloblastoma 1875 0.00344624324548504
atypical teratoid / rhabdoid tumor 4369 0.00475476112252776
chronic rhinosinusitis 512 0.00853973032354001
invasive ductal carcinoma 2950 0.00915274244852777
pituitary cancer 1972 0.0129240834238871
astrocytic glioma 2241 0.0172040000496767
active Crohn's disease 918 0.0250158476732224
primitive neuroectodermal tumor 3031 0.0275005820603914
ependymoma 2514 0.0297041042926957
oligodendroglioma 2849 0.0406922211505231
spina bifida 1064 0.0407734452079813
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Epidermolysis bullosa 21 4.713 2.4
Disease Target Count Z-score Confidence
Kindler syndrome 10 3.815 1.9

Expression

  Differential Expression (29)

Synonym

Accession Q8NEV8 Q2KHM1 Q9Y4D6
Symbols SLAC2B
SLAC2-B

Gene

  Ortholog (10)

Gene RIF (5)

PMID Text
25940347 Silencing the expression of SLAC2B leads to a diffuse intracellular HIV-1 Gag staining pattern accompanied by a dramatic reduction in the association of Gag with the plasma membrane
25940347 Silencing of SLAC2B by shRNA inhibits HIV-1 replication in Jurkat cells
24005056 Here, we report the second family with two EXPH5 mutations in epidermolysis bullosa simplex.
23176819 our findings identify an unexpected role for Slac2-b in inherited skin fragility and expand the clinical spectrum of human disorders of GTPase effector proteins.
11773082 Slac2-b/KIAA0624 contains an N-terminal Slp homology domain (SHD) (PMID: 11327731). The SHD of Slac2-b specifically and directly binds the GTP-bound form of Rab27A (J. Biol. Chem. 277, (2002) 9212-9218; PMID: 11773082).

AA Sequence

MTKVPPAFDFSFLNDEEARKILQVLERNEELQRAEKDRISKLQKTKRDIRWLQGVTGEWFEEIQRKKFCN      1 - 70
ETDVSQMLKQPLTYRLSKEMAKNDPIELPTSRSKNVTNQKKPTPFSSRMSFRSSFASLFSFRKSGKETSK     71 - 140
LPSLGQKGCDGHAGPPMPVRGAAVQAKIYNSPLENHLVDSTFVPKPAVMREESGMPPPWDASLLENEFFQ    141 - 210
VLDDLDSKLAQEQSASSVNTRTPLNYGSRTQFGHFYSSGNRHGNITERHKKHYNETSNMSIYDILRPGTP    211 - 280
REGFKTFSPRTSTIYDMYRTREPRVFKEDYVQKNTFGSTSLCFDSRQRSALPATGHFTARSLHFPATTQS    281 - 350
KSGFIPPRHQQSPKRTPLSSIIWNRSDSSRDRENQEEFLRAPSPMEIDPADKYVYPRGFQENKRYESYHS    351 - 420
QNVYQRVSLNAPMENAMSPDTFENSENMPFYHQSNTFTRSFFSNTFGRSGEQRRFGQGPFWGQEKGHSFW    421 - 490
SDFHRSRKSFSSSDRDFEMISMEANSVSAIHGHNVSSEHWESFSSGYGTDVSRGQEEPHPWQFDFQRSTL    491 - 560
DSMVVSHGNETQLTPHFGTPNVCSMTGSSYHVKSSELVSQQDSSPVEVHINKEASSFGIAQTLASSFKTS    561 - 630
FSQISDDRRNPQSPNLQNPTVTLQKIFPNKPASHPMRSHTEVTVTSSNSVDSLPLAKSQPNILVTEVNNE    631 - 700
KDLNESISEEDKQLSKMDQTNKAGEIPQPVSQTGISNSLPDFQNPLSQDSAKSNGFGFNASTIISSKKSP    701 - 770
RVFSRKDTSKMYIPHTDKSNDIKQDKRFTENRKLGSTASLPFIQEHRTPPSFPRTDQGCHQELTVNNEDI    771 - 840
SRIITNNHWSSALTDTQNAQYSKCKLTPGHKTSCDSLDLSSAALPDSSPSKNSSLDAPVVPSTTVFSRRS    841 - 910
PSDKDPSLGEREEKDNAGKNQKNQFIVSHSENQERNDSPVPTHDEVVDVKCHSHSPFRNERGKGKIRHHI    911 - 980
SCIEKLSKTESISVPTSDHRSLIEANQSNSKVSELDTIYCTLPRKSSSFLIHGRQSGSKIMAASLRNGPP    981 - 1050
PFQIKNNVEDAMGNYMLNKFSPSSPESANECSKVLSDSALEAPEATERMTNVKSSGSTSVRKGPLPFLIN   1051 - 1120
RAMSCPSGEPHASTGREGRKKPLTSGMDASELTPRAWERIISPVESDSSVRDCSLTKRQHQKENFQEYTE   1121 - 1190
KEGKMAASRRSVFALSNEDPLPFCSDLSGKERGKTLHKVKTTSTFSVSGDEDNVKCLEVVSIYYTLPRKP   1191 - 1260
SKKFCNLLQQYTQNTNLLIESPQVETETFPNALEKDKQNYSTREQSGTPSCENLKMSVNSDQTLTTENMT   1261 - 1330
AFRLSNRGPLAPTLQEMASVEAAVSLPEEESKAREIFSDNLAKTPLGDSENKKERGKKLQSETLHTSLML   1331 - 1400
QRKNVSEEKSENCQQSINSSNSGPSSLPALSEVNIGNSQTRRSSWECTGSGRAIPFTGSGKCPQKDHTST   1401 - 1470
AVGDGSSGSQPREGRGDIGTNCQKMTNKTLSHSESQVFALTPALHKLQLGEETQSDEPNLESLQSEPREL   1471 - 1540
PQRSQEANMTESRKAEDEMQKSAWDQPSLPEGNKNKTNLDDLVKGENRSSVKHRLAAMSKASRKFPAKDV   1541 - 1610
SPRRHVATIFPQSGSRSGFDHLSLGTVECNPLFPEPTPKSAESIGESRLSENGKHVKKSENLLPITVLPN   1611 - 1680
REPSTHVSNQKSNSISQRHQNEFKNVSESPSKHENSKDVTAAQNLVRESGAPSPITFTSLREAEFSDNQR   1681 - 1750
RLSPPFPLEPAQKSRVSSPLASFLQQQRSASSLEWEPEPHLYRSKSLKSINVHGDLLRKSHPPKVRERHF   1751 - 1820
SESTSIDNALSRLTLGNEFSVNNGYSRRFRSFSELPSCDGNESWAYRSGTKTGPRSAISIYRPIDYGIFG   1821 - 1890
KEQQLAFLENVKRSLTQGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPLNIYE   1891 - 1960
DDPVDSNCDTDTTTDDEYYLDENDKESEL                                            1961 - 1989
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24005056 2014 Molecular heterogeneity of epidermolysis bullosa simplex: contribution of EXPH5 mutations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23176819 2012 Germline Mutation in EXPH5 Implicates the Rab27B Effector Protein Slac2-b in Inherited Skin Fragility.
19966785 2010 Rab27a and Rab27b control different steps of the exosome secretion pathway.
16880209 2006 Constitutive GDP/GTP exchange and secretion-dependent GTP hydrolysis activity for Rab27 in platelets.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...