Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.58
PubTator Score 11.38

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 1.22783986024909E-7
glioblastoma 5572 3.96319759670274E-6
pediatric high grade glioma 2712 4.2176681085581E-5
medulloblastoma 1524 1.00959330565977E-4
pilocytic astrocytoma 3086 1.81272113409717E-4
atypical teratoid / rhabdoid tumor 4369 2.18214619751953E-4
ovarian cancer 8492 2.74486847097365E-4
oligodendroglioma 2849 9.36515109980361E-4
astrocytic glioma 2241 0.00316368075939761
chronic rhinosinusitis 512 0.0223702656271289
ependymoma 2514 0.0242244552865885
Rheumatoid Arthritis 1171 0.035199665628898


  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.035
astrocytic glioma 1.500 0.003
ependymoma 1.300 0.024
oligodendroglioma 1.700 0.001
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.800 0.000
medulloblastoma 1.500 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.100 0.000
ulcerative colitis -1.600 0.000
ovarian cancer -1.300 0.000
chronic rhinosinusitis -1.331 0.022




5C5B   4H8S  

  Ortholog (10)

Gene RIF (13)

26583432 Data show that signal transducing adaptor proteins APPL1 and APPL2 are required for TGFbeta-induced nuclear translocation of TGFbeta type I receptor (TbetaRI)-ICD and for cancer cell invasiveness of prostate and breast cancer cell lines.
24763056 ATM is the central modulator of APPL-mediated effects on radiosensitivity and DNA repair.
23977033 C-APPL1/A-APPL2 allele combination is associated with non-alcoholic fatty liver disease occurrence, with a more severe hepatic steatosis grade and with a reduced adiponectin cytoprotective effect on liver.
23891720 It concludes that APPL2(PH) binding to BAR domain and Reptin is mutually exclusive which regulates the nucleocytoplasmic shuttling of Reptin.
23055524 analysis of APPL1 and APPL2 proteins and their interaction with Rab
22989406 Data indicate that a high level of APPL2 protein might enhance glioblastoma growth by maintaining low expression level of genes responsible for cell death induction.
22462604 found significant evidence of association with overweight/obesity for rs2272495 and rs1107756. rs2272495 C allele and rs1107756 T allele both conferred a higher risk of being overweight and obese.
22340213 Genetic variation(s) in APPL1/2 may be associated with CAD risk in T2DM in Chinese population.
21645192 Data suggest that although annexin A2 is not an exclusive marker of APPL1/2 endosomes, it has an important function in membrane recruitment of APPL proteins, acting in parallel to Rab5.
20814572 significant fluorescence resonance energy transfer between APPL minimal BAR domain FRET pairs

AA Sequence

SIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA                                        631 - 664

Text Mined References (27)

PMID Year Title
26583432 2016 APPL proteins promote TGF?-induced nuclear transport of the TGF? type I receptor intracellular domain.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24763056 2014 APPL proteins modulate DNA repair and radiation survival of pancreatic carcinoma cells by regulating ATM.
23977033 2013 Association of genetic variation in adaptor protein APPL1/APPL2 loci with non-alcoholic fatty liver disease.
23891720 2013 Mutually exclusive binding of APPL(PH) to BAR domain and Reptin regulates ?-catenin dependent transcriptional events.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23055524 2012 Membrane curvature protein exhibits interdomain flexibility and binds a small GTPase.
22989406 2013 Multifunctional protein APPL2 contributes to survival of human glioma cells.