Property Summary

NCBI Gene PubMed Count 35
Grant Count 51
R01 Count 24
Funding $8,322,217.13
PubMed Score 111.55
PubTator Score 86.13

Knowledge Summary

Patent (51,427)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 0.000

Gene RIF (29)

PMID Text
26453324 these data suggest that TRPV3 sparklets cause dilation of cerebral parenchymal arterioles by activating IK and SK channels in the endothelium
26067147 TRPV3 missense mutation identified as a cause of the rare Olmsted syndrome.
25829496 this study provides powerful tools to broaden our understanding of ligand interaction with TRPV channels, and the availability of purified human TRPV3 opens up perspectives for further structural and functional studies
25774551 Study illustrates the antiadipogenic role of TRPV3 in the adipocytes.
25413349 Hypoxia, FIH inhibitors and mutation of asparagine 242 all potentiated TRPV3-mediated current, without altering TRPV3 protein levels, indicating that oxygen-dependent hydroxylation inhibits TRPV3 activity.
25333484 Using multiple sequence alignments as source for evolutionary, bioinformatics and statistical analysis, we have analyzed the evolutionary profiles for TRPV1, TRPV2, TRPV3 and TRPV4
25285920 A mutation in TRPV3 causes focal palmoplantar keratoderma in a Chinese family.
24695993 TPRV3 was significantly elevated in the epidermis of burn scars with pruritus.
24463422 a TRPV3 mutation has a role in Olmsted syndrome [case report]
24452206 TRPV3 missense mutation found in patient with Olmsted syndrome.
More...

AA Sequence

MKAHPKEMVPLMGKRVAAPSGNPAILPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTSPPVFSKPMDS      1 - 70
NIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLKKRIFAAVSEGCVEELVELLV     71 - 140
ELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNINPNTKEIVRILLAFAEENDILGRFINAEYTE    141 - 210
EAYEGQTALNIAIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQL    211 - 280
LMEHEQTDITSRDSRGNNILHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAK    281 - 350
MGKAEILKYILSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML    351 - 420
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFV    421 - 490
LIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWA    491 - 560
NMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLGFGVALASLIEKCPKDNKDCSSYGSFSDAVL    561 - 630
ELFKLTIGLGDLNIQQNSKYPILFLFLLITYVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTI    631 - 700
LEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRN    701 - 770
NSKTTLNAFEEVEEFPETSV                                                      771 - 790
//

Text Mined References (36)

PMID Year Title
26453324 2015 Unitary TRPV3 channel Ca2+ influx events elicit endothelium-dependent dilation of cerebral parenchymal arterioles.
26067147 2015 Expanding the Phenotypic Spectrum of Olmsted Syndrome.
25829496 2015 Different ligands of the TRPV3 cation channel cause distinct conformational changes as revealed by intrinsic tryptophan fluorescence quenching.
25774551 2015 Activation of transient receptor potential vanilloid 3 channel suppresses adipogenesis.
25413349 2015 Oxygen-dependent hydroxylation by FIH regulates the TRPV3 ion channel.
25333484 2014 Dissecting domain-specific evolutionary pressure profiles of transient receptor potential vanilloid subfamily members 1 to 4.
25285920 2015 A gain-of-function mutation in TRPV3 causes focal palmoplantar keratoderma in a Chinese family.
24695993 2015 Increased expression of three types of transient receptor potential channels (TRPA1, TRPV4 and TRPV3) in burn scars with post-burn pruritus.
24463422 2014 Olmsted syndrome caused by a homozygous recessive mutation in TRPV3.
24452206 2014 A new TRPV3 missense mutation in a patient with Olmsted syndrome and erythromelalgia.
More...