Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.95
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.297 0.004
tuberculosis 1.900 0.000
active Crohn's disease -1.826 0.007
active ulcerative colitis -1.338 0.019

Synonym

Accession Q8NET6 Q3SYA3 Q3SYA5
Symbols C4ST3

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
20580388 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of carbohydrate sulfotransferase 13 (CHST13) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12080076 mol cloning and characterization

AA Sequence

MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVH      1 - 70
RQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISA     71 - 140
QEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARPYSAAFQRRYGARIVQRLRP    141 - 210
RALPDARARGHDVRFAEFLAYLLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGL    211 - 280
AGASDLSFPGPPRPRGAAASRDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL             281 - 341
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20580388 2010 Natural frequency of polymorphisms linked to the chondroitin 4-sulfotransferase genes and its association with placental malaria.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080076 2002 Molecular cloning and characterization of chondroitin-4-O-sulfotransferase-3. A novel member of the HNK-1 family of sulfotransferases.
10781601 2000 Molecular cloning and expression of two distinct human chondroitin 4-O-sulfotransferases that belong to the HNK-1 sulfotransferase gene family.