Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.95
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 4.04807011389756E-6
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00418768728162085
active Crohn's disease 918 0.00700024091647248
active ulcerative colitis 477 0.0185626846356696

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.297 0.004
tuberculosis 1.900 0.000
active Crohn's disease -1.826 0.007
active ulcerative colitis -1.338 0.019

Synonym

Accession Q8NET6 Q3SYA3 Q3SYA5
Symbols C4ST3

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (3)

PMID Text
20580388 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of carbohydrate sulfotransferase 13 (CHST13) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12080076 mol cloning and characterization

AA Sequence

MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVH      1 - 70
RQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISA     71 - 140
QEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARPYSAAFQRRYGARIVQRLRP    141 - 210
RALPDARARGHDVRFAEFLAYLLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGL    211 - 280
AGASDLSFPGPPRPRGAAASRDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL             281 - 341
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20580388 2010 Natural frequency of polymorphisms linked to the chondroitin 4-sulfotransferase genes and its association with placental malaria.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080076 2002 Molecular cloning and characterization of chondroitin-4-O-sulfotransferase-3. A novel member of the HNK-1 family of sulfotransferases.
10781601 2000 Molecular cloning and expression of two distinct human chondroitin 4-O-sulfotransferases that belong to the HNK-1 sulfotransferase gene family.