Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.31
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
19194307 Observational study of gene-disease association. (HuGE Navigator)
12600824 The encoded protein is thought to have antimicrobial activity.

AA Sequence

MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP      1 - 70
KKD                                                                        71 - 73
//

Text Mined References (4)

PMID Year Title
19194307 2009 Copy number variation of defensin genes and HIV infection in Brazilian children.
12734011 2003 Duplication and selection in the evolution of primate beta-defensin genes.
12600824 2003 ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.