Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.30
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP      1 - 70
KKD                                                                        71 - 73
//

Text Mined References (4)

PMID Year Title