Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.76
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.6e-04
diabetes mellitus 1728 1.8e-03
astrocytic glioma 2597 2.5e-02
Breast cancer 3578 2.6e-02

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.100 2.5e-02
Breast cancer -3.600 2.6e-02
diabetes mellitus 1.500 1.8e-03
medulloblastoma, large-cell 1.100 1.6e-04

Synonym

Accession Q8NES8 Q30E74
Symbols DEFB-24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEY      1 - 70
E//

Text Mined References (4)

PMID Year Title