Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.100 0.025
medulloblastoma, large-cell 1.100 0.000
diabetes mellitus 1.500 0.002
Breast cancer -3.600 0.026

Gene RIF (1)

PMID Text
24955228 The encoded protein is thought to display antimicrobial activity and may enhance innate immunity in the prostate.

AA Sequence

MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEY      1 - 70
E//

Text Mined References (4)

PMID Year Title
24955228 2014 Beta-Defensin 124 Is Required for Efficient Innate Immune Responses in Prostate Epithelial RWPE-1 Cells.
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.