Property Summary

NCBI Gene PubMed Count 17
PubMed Score 29.76
PubTator Score 22.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

Gene RIF (5)

AA Sequence

MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAAAAAPGALVRD      1 - 70
VHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTKKFHRARLDLLLETWISR     71 - 140
HKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRAL    141 - 210
LRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMN    211 - 280
TAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPF    281 - 350
SVEADPSRFRSIHCHLYPDTPWCPRTAIF                                             351 - 379
//

Text Mined References (19)

PMID Year Title