Property Summary

NCBI Gene PubMed Count 15
Grant Count 26
R01 Count 10
Funding $1,286,381.29
PubMed Score 28.48
PubTator Score 22.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24709423 LFNG expression correlates with expansion of cancer stem cell populations and NKX3.1 expression in human prostate cancer.
22624713 Reduced LFNG expression facilitates JAG/NOTCH luminal progenitor signaling and cooperates with MET/CAVEOLIN basal-type signaling to promote basal-like breast cancer.
16385447 Mutation of the LFNG gene causes spondylocostal dysostosis with a severe vertebral phenotype, reinforcing the hypothesis that proper regulation of the Notch signaling pathway is an absolute requirement for the correct patterning of the axial skeleton.

AA Sequence

MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAAAAAPGALVRD      1 - 70
VHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTKKFHRARLDLLLETWISR     71 - 140
HKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRAL    141 - 210
LRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMN    211 - 280
TAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPF    281 - 350
SVEADPSRFRSIHCHLYPDTPWCPRTAIF                                             351 - 379
//

Text Mined References (17)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24709423 2014 Tumor-suppressive activity of Lunatic Fringe in prostate through differential modulation of Notch receptor activation.
22624713 2012 Lunatic fringe deficiency cooperates with the Met/Caveolin gene amplicon to induce basal-like breast cancer.
19061953 2009 Mutation of the fucose-specific beta1,3 N-acetylglucosaminyltransferase LFNG results in abnormal formation of the spine.
19020755 2008 Activation of Notch signaling in human colon adenocarcinoma.
18485326 2008 Mutations in the MESP2 gene cause spondylothoracic dysostosis/Jarcho-Levin syndrome.
16385447 2006 Mutation of the LUNATIC FRINGE gene in humans causes spondylocostal dysostosis with a severe vertebral phenotype.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...