Property Summary

NCBI Gene PubMed Count 23
PubMed Score 40.47
PubTator Score 29.40

Knowledge Summary

Patent (8,995)

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis -1.354 4.1e-02
adult high grade glioma -1.400 3.4e-04
astrocytic glioma -1.800 1.5e-03
Astrocytoma, Pilocytic -2.000 1.1e-06
atypical teratoid / rhabdoid tumor -1.700 1.1e-05
breast carcinoma -2.000 3.0e-03
ductal carcinoma in situ -4.500 4.4e-05
ependymoma -2.400 1.4e-03
fibroadenoma -2.700 1.1e-02
glioblastoma -2.000 1.2e-08
group 3 medulloblastoma -2.100 9.1e-05
invasive ductal carcinoma -5.600 7.2e-05
lung carcinoma 3.000 5.8e-15
medulloblastoma, large-cell -2.300 4.9e-05
non-small cell lung cancer 1.169 5.6e-09
oligodendroglioma -1.400 2.1e-02
osteosarcoma 1.890 3.5e-02
ovarian cancer -1.500 1.5e-07
primitive neuroectodermal tumor -2.300 2.8e-04
psoriasis -1.600 2.0e-05

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (17)

AA Sequence

MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELN      1 - 70
AQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVPVCLLSIAAMLTVWACQGRQ     71 - 140
CSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSGSGLPLLVQRTIARTIVLQEIVGKGRFGEVW    141 - 210
HGRWCGEDVAVKIFSSRDERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYD    211 - 280
YLNRNIVTVAGMIKLALSIASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDS    281 - 350
ILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD    351 - 420
MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKKTISQLCVKED    421 - 490
CKA                                                                       491 - 493
//

Text Mined References (24)

PMID Year Title