Property Summary

NCBI Gene PubMed Count 23
Grant Count 7
R01 Count 7
Funding $462,030.5
PubMed Score 36.14
PubTator Score 29.40

Knowledge Summary

Patent (8,995)

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.800 0.002
ependymoma -2.400 0.001
oligodendroglioma -1.400 0.021
glioblastoma -2.100 0.000
osteosarcoma 1.890 0.035
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -2.300 0.000
non-small cell lung cancer 1.169 0.000
ulcerative colitis -1.800 0.000
breast carcinoma -2.000 0.003
fibroadenoma -2.700 0.011
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -2.000 0.000
psoriasis -1.600 0.000
lung carcinoma 3.000 0.000
ductal carcinoma in situ -4.500 0.000
invasive ductal carcinoma -5.600 0.000
ovarian cancer -1.700 0.000

Gene RIF (17)

PMID Text
26406402 Loss of ALK7 expression are associated with invasion, metastasis of the pancreatic ductal adenocarcinoma.
26289399 Alk7 is expressed in male germ cells and Sertoli cells.
23793810 ACVR 1C is a tumor suppressor, and lowered ACVR 1C expression is an important marker for the metastasis, invasion, and prognosis of gallbladder cancer.
23765385 Our findings suggested that the ALK7 gene polymorphism rs13010956 was significantly associated with metabolic syndrome risk in females and may be involved in cardiovascular remodeling in metabolic syndrome patients.
22086737 reduction or lack of ALK7 expression may account for the loss of its ligand sensitivity of breast cancer cells, thereby leading to breast tumor progression.
21356369 These findings suggest that the Nodal/ALK7 pathway plays important roles in human placentation and that its abnormal signaling may contribute to the development of preeclampsia.
20734064 Observational study of gene-disease association. (HuGE Navigator)
19275893 Microarray analysis showed that adipose tissue expressed activin type I and II receptors and that the expression of activin receptor-like kinase 7 was adipose tissue specific.
18951876 One of the direct target genes in the ALK7 signaling pathway is the insulin gene in pancreatic beta-cells, and that PDX-1 is directly involved in this pathway through interaction with Smad2 and Smad3.
18784254 The antiproliferative effect of Nodal/ALK7 on ovarian cancer cells is in part mediated by cyclin G2.
More...

AA Sequence

MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELN      1 - 70
AQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVPVCLLSIAAMLTVWACQGRQ     71 - 140
CSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSGSGLPLLVQRTIARTIVLQEIVGKGRFGEVW    141 - 210
HGRWCGEDVAVKIFSSRDERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYD    211 - 280
YLNRNIVTVAGMIKLALSIASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDS    281 - 350
ILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD    351 - 420
MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKKTISQLCVKED    421 - 490
CKA                                                                       491 - 493
//

Text Mined References (24)

PMID Year Title
26406402 2015 Overexpression of B2M and loss of ALK7 expression are associated with invasion, metastasis, and poor-prognosis of the pancreatic ductal adenocarcinoma.
26289399 NODAL secreted by male germ cells regulates the proliferation and function of human Sertoli cells from obstructive azoospermia and nonobstructive azoospermia patients.
23793810 2014 PKM2 and ACVR 1C are prognostic markers for poor prognosis of gallbladder cancer.
23765385 2013 ALK7 gene polymorphism is associated with metabolic syndrome risk and cardiovascular remodeling.
22086737 2012 Reduced expression of activin receptor-like kinase 7 in breast cancer is associated with tumor progression.
21805089 2012 The conditioned medium from a stable human GDF3-expressing CHO cell line, induces the differentiation of PC12 cells.
21356369 2011 Nodal signals through activin receptor-like kinase 7 to inhibit trophoblast migration and invasion: implication in the pathogenesis of preeclampsia.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19275893 2009 ALK7 expression is specific for adipose tissue, reduced in obesity and correlates to factors implicated in metabolic disease.
18951876 2008 Insulin gene is a target in activin receptor-like kinase 7 signaling pathway in pancreatic beta-cells.
More...