Property Summary

NCBI Gene PubMed Count 276
Grant Count 880
R01 Count 543
Funding $133,455,147.99
PubMed Score 1625.17
PubTator Score 1421.02

Knowledge Summary

Patent (128,541)

Expression

Synonym

Gene

PANTHER Protein Class (2)

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
488979 confirmatory 0 / 76 / 1149 HTS Assay for Compounds that Act as Enhancers of the Vanilloid Receptor 1
488988 summary 0 / 0 / 0 HTS Assay for Compounds that Act as Enhancers of the Vanilloid Receptor 1: Summary
540275 screening 617 / 19352 / 297005 HTS Assay for Compounds that Act as Agonists of the Vanilloid Receptor 1
540277 screening 53 / 9844 / 307077 HTS Assay for Compounds that Act as Potentiators of the Vanilloid Receptor 1
588633 other 66 / 0 / 31 Confirmatory screen for compounds that act as agonists of the Vanilloid Receptor 1 using automated patch clamp
602331 other 2 / 0 / 5 Confirmatory screen for compounds that act as allosteric agonists of TRPV1 using QPatch automated patch clamp
623958 confirmatory 0 / 0 / 1358 qHTS Assay for Compounds that Act as Agonists of the Vanilloid Receptor 1: Hit Validation
623959 confirmatory 3 / 109 / 1246 qHTS Assay for Compounds that Act as Potentiators of the Vanilloid Receptor 1: Hit Validation
623960 confirmatory 1 / 0 / 0 qHTS Assay for Compounds that Act as Agonists of the Vanilloid Receptor 1: Hit Validation in Parental Cell Line Calcium Assay

Gene RIF (255)

PMID Text
27333657 It is expressed in the unmyelinated C fiber nociceptors and activated by various nociceptive stimuli causing pain in our body.(review)
27038373 the major objective of this review is to highlight the fact that TRPV1 channel can be treated as an effective therapeutic target for treating several pain- and nonpain-related physiological and pathological states.
26755770 No change in tmFRET was observed with the TRPV1 agonist capsaicin.
26753651 high expression of TRPV1 in urothelium of female overactive bladder(OAB) patients is closely correlated to OAB occurrence.
26752109 HRH1-mediated sensitization of TRPV1 is involved in IBS. Ebastine, an antagonist of HRH1, reduced visceral hypersensitivity, symptoms, and abdominal pain in patients with IBS.
26702055 Thus, the hTRPV1 channel has a heterogeneous subunit composition in terms of both redox status and function.
26700618 Data show that the number of transient receptor potential vanilloid 1 (TRPV1)+/CD4+ inflammatory cells increased in the nasal mucosa of patients with allergic rhinitis (AR), compared with that of control subjects.
26645885 The effects of specific agents on TRPV1 and TRPM8 channels are intricately interrelated.
26530852 TRPV1 was expressed in tongue, epiglottis, and pharynx, with higher levels in CN V region (tongue) than in CN X region (epiglottis), and was localized at epithelial cells and nociceptive fibers in all studied regions.
26490328 activation of astrocytic TRPV1 activates endogenous neuroprotective machinery in vivo and it is a novel therapeutic target for the treatment of Parkinson's disease
More...

AA Sequence

MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGEL      1 - 70
DSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKS     71 - 140
KKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQTALHIAI    141 - 210
ERRNMALVTLLVENGADVQAAAHGDFFKKTKGRPGFYFGELPLSLAACTNQLGIVKFLLQNSWQTADISA    211 - 280
RDSVGNTVLHALVEVADNTADNTKFVTSMYNEILMLGAKLHPTLKLEELTNKKGMTPLALAAGTGKIGVL    281 - 350
AYILQREIQEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLN    351 - 420
RLLQDKWDRFVKRIFYFNFLVYCLYMIIFTMAAYYRPVDGLPPFKMEKTGDYFRVTGEILSVLGGVYFFF    421 - 490
RGIQYFLQRRPSMKTLFVDSYSEMLFFLQSLFMLATVVLYFSHLKEYVASMVFSLALGWTNMLYYTRGFQ    491 - 560
QMGIYAVMIEKMILRDLCRFMFVYIVFLFGFSTAVVTLIEDGKNDSLPSESTSHRWRGPACRPPDSSYNS    561 - 630
LYSTCLELFKFTIGMGDLEFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKL    631 - 700
QRAITILDTEKSFLKCMRKAFRSGKLLQVGYTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGV    701 - 770
KRTLSFSLRSSRVSGRHWKNFALVPLLREASARDRQSAQPEEVYLRQFSGSLKPEDAEVFKSPAASGEK     771 - 839
//

Text Mined References (278)

PMID Year Title
27333657 2016 [Thermosensitive TRP channels and brain function].
27038373 2016 Polymodal Transient Receptor Potential Vanilloid Type 1 Nocisensor: Structure, Modulators, and Therapeutic Applications.
26755770 2016 Measuring distances between TRPV1 and the plasma membrane using a noncanonical amino acid and transition metal ion FRET.
26753651 Expression and diagnosis of transient receptor potential vanilloid1 in urothelium of patients with overactive bladder.
26752109 2016 Histamine Receptor H1-Mediated Sensitization of TRPV1 Mediates Visceral Hypersensitivity and Symptoms in Patients With Irritable Bowel Syndrome.
26702055 2016 Functional and Structural Divergence in Human TRPV1 Channel Subunits by Oxidative Cysteine Modification.
26700618 2016 The role of TRPV1 in the CD4+ T cell-mediated inflammatory response of allergic rhinitis.
26645885 2016 Reciprocal effects of capsaicin and menthol on thermosensation through regulated activities of TRPV1 and TRPM8.
26530852 2016 Localization and expression of TRPV1 and TRPA1 in the human oropharynx and larynx.
26490328 2015 TRPV1 on astrocytes rescues nigral dopamine neurons in Parkinson's disease via CNTF.
More...