Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.86
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.600 2.9e-06
Astrocytoma, Pilocytic -1.200 5.9e-06
atypical teratoid / rhabdoid tumor -1.600 5.5e-07
Breast cancer -2.200 2.0e-04
breast carcinoma 1.900 6.4e-03
glioblastoma -1.300 1.1e-03
group 4 medulloblastoma -1.300 3.6e-05
medulloblastoma, large-cell -1.600 7.9e-06
ovarian cancer -1.100 7.7e-05
posterior fossa group A ependymoma -1.100 1.6e-06
primitive neuroectodermal tumor -1.200 1.5e-04
psoriasis -1.100 5.8e-03

Gene RIF (2)

AA Sequence

MAPSEDPRDWRANLKGTIRETGLETSSGGKLAGHQKTVPTAHLTFVIDCTHGKQLSLAATASPPQAPSPN      1 - 70
RGLVTPPMKTYIVFCGENWPHLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPV     71 - 140
KAAPVRSSTWGTVKDSLKALSSCVCGQAD                                             141 - 169
//

Text Mined References (8)

PMID Year Title