Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.00
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.300 0.001
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.200 0.000
breast carcinoma 1.900 0.006
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.200 0.000
posterior fossa group A ependymoma -1.100 0.000
ovarian cancer -1.100 0.000
Breast cancer -2.200 0.000
psoriasis -1.100 0.006

Synonym

Accession Q8NEQ6 B3KXI9
Symbols ERRF

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
22341523 These results suggest that ERRF plays a role in estrogen-ER-mediated growth of breast cancer cells.

AA Sequence

MAPSEDPRDWRANLKGTIRETGLETSSGGKLAGHQKTVPTAHLTFVIDCTHGKQLSLAATASPPQAPSPN      1 - 70
RGLVTPPMKTYIVFCGENWPHLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPV     71 - 140
KAAPVRSSTWGTVKDSLKALSSCVCGQAD                                             141 - 169
//

Text Mined References (7)

PMID Year Title
27125460 2016 ERRF is essential for Estrogen-Estrogen Receptor alpha signaling pathway in ER positive breast cancer cells.
22341523 2012 Role of ERRF, a novel ER-related nuclear factor, in the growth control of ER-positive human breast cancer cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.