Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.70
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.4e-04
group 3 medulloblastoma 4104 3.5e-04
primitive neuroectodermal tumor 3035 1.8e-03
spina bifida 1074 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 3.5e-04
osteosarcoma -1.049 2.4e-04
primitive neuroectodermal tumor 1.100 1.8e-03
spina bifida -2.393 4.6e-02

Gene RIF (1)

AA Sequence

MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFQNLASVDDETQFKASGSVSQQDIYGEKIPKESK      1 - 70
IATFTRNVSWASVLGKIWDSLSIEDQTTNQGRNLSRNHGLERLCESNDQCGEALSQIPHLNLYKKIPPGV     71 - 140
KQYEYNTYGKVFMHRRTSLKSPITVHTGHKPYQCQECGQAYSCRSHLRMHVRTHNGERPYVCKLCGKTFP    141 - 210
RTSSLNRHVRIHTAEKTYECKQCGKAFIDFSSLTSHLRSHTGEKPYKCKECGKAFSYSSTFRRHTITHTG    211 - 280
EKPYKCKECAEAFSYSSTFRRHMISHTGEKPHKCKECGEAFSYSSAFRRHMITHTGEKPYECKQCGKTFI    281 - 350
YLQSFRRHERIHTGEKPYECKQCGKTFIYPQSFRRHERTHGGEKPYECNQCGKAFSHPSSFRGHMRVHTG    351 - 420
EKPYECKQCGKTFNWPISLRKHMRTHTREKPYECKQCGKAFSLSACFREHVRMHPEDKSYECKLCGKAFY    421 - 490
CHISLQKHMRRHTAEKLYKCKQCGKAFSWPELLQQHVRTHTVEKPYECKECGKVFKWPSSLPIHMRLHTG    491 - 560
EKPYQCKHCGKAFNCSSSLRRHVRIHTTEKQYKCNVGHPPANEFMCSASEKSHQERDLIKVVNMVLPL      561 - 628
//

Text Mined References (13)

PMID Year Title