Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 4.8e-03
glioblastoma -1.400 3.3e-04
interstitial cystitis -1.100 2.2e-04
invasive ductal carcinoma 1.400 3.3e-03
medulloblastoma -1.100 1.3e-02
medulloblastoma, large-cell -1.900 7.1e-05
pediatric high grade glioma -1.200 4.3e-05
pituitary cancer 1.100 4.2e-06
psoriasis -1.100 1.0e-27

AA Sequence

MAVAVPPGRAAGSGWAWRPVARDALLARAFHSCTELRGRFYLVGGLLAGGAREPSSDTVVFDPARGQAVR      1 - 70
LGARGSPPRSHHDAAPVDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRI     71 - 140
SDRELQVAGREGGIHTQRRYGSIYTLRLDPSARTYCYKQEGCHTASRSGHCAALLQTPGPHPGHQLLLFG    141 - 210
GCNLAEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSCSVVGPFAVLFGGETLT    211 - 280
RARDTICNDLYIYDTRTSPPLWFHFPCADRGMKRMGHRTCLWNDQLYLVGGFGEDGRTASPQVCILDFI     281 - 349
//

Text Mined References (9)

PMID Year Title